Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Answers

Answer 1

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:


Related Questions

Why are the five components of food essential to health? what are the consequences when these components are missing from a diet?

Answers

Proteins, fats, sugars, dietary fiber, carbs, vitamins, and minerals are the five components of food essential to health.

Roles of the five primary nutrients. The nutrients found in food are what power biological activity and are essential to maintaining human health. These molecules, which are classified as proteins, lipids, carbohydrates (sugars, dietary fiber), vitamins, and minerals, perform the following crucial tasks. Today, it is well established that inadequate intakes of particular nutrients increase the chance of contracting chronic diseases such as various.Cancers, heart disease, diabetes, osteoporosis, and depression. The health of the unborn kid could be negatively impacted long-term by inadequate vitamin intake during pregnancy. Eating a range of foods from the five major food groups keeps your diet interesting with a diversity of flavors and textures, while also giving your body a range of nutrients, supporting general health, and maybe lowering your risk of certain diseases.Learn more about food here brainly.com/question/2285052

#SPJ4.

Which symptom of penumonia may present differently in the older adult than in the younger adult?

Answers

Answer:

Older people may not have a fever, even when they have a serious case of pneumonia. Rather than the typical symptoms, the elderly person might be more lethargic or sleepy; they may have a loss of appetite or may be dizzy, resulting in falls.

Explanation:

pls give brainliest

The hormone _______ controls the milk letdown reflex and plays a role in formation of social bonds.

Answers

The hormone oxytocin controls the milk letdown reflex and plays a role in formation of social bonds.

What are hormones?

Hormones can be defined as those chemical messangers or substances which are released to sites where they are need to effect action within the body system

Some few examples of hormones are:

AdrenalineInsulinGlucagonAntidiuretic hormones

So therefore, the hormone oxytocin controls the milk letdown reflex and plays a role in formation of social bonds.

Learn more about hormones:

https://brainly.com/question/8162998

#SPJ1

Research about the ability of infants to distinguish human speech sounds indicates that?

Answers

Research about the ability of infants to distinguish human speech sounds indicates that the infants gradually come to distinguish best the speech sounds of the language spoken around them.

How do infants distinguish speech sounds?From birth to 6 months old, infants can distinguish the vowels and consonants of all the different languages spoken.At 9 months they can make distinction between speech and non-speech sounds of human and animals respectively.Newborns can differentiate between any universal languages and have the ability to learn any sound which humans utter.However as they grow they begin to have difficulties in pronouncing non native languages.They follow the rhythm of speech and sound and thus start uttering words.They learn by listening to the voices of the world around them, by lip reading and matching faces to “eh”, “ah” sounds.

Learn more about how babies talk here:

https://brainly.com/question/10206066

#SPJ4

All neural activity during sleep is directed toward dreaming. please select the best answer from the choices provided t f

Answers

False

The statement "All neural activity during sleep is directed toward dreaming" is False.

As it was always thought that sleep was a passive process, but one that was essential for proper body processes, we now know that brain activity continues while we sleep. In fact, it is believed that this brain activity contributes significantly to the preservation of one's physical, emotional, and mental health.What happens to the brain while you sleep?Sleep is crucial for several brain processes, including the communication between nerve cells (neurons). In actuality, even while you sleep, your body and brain are surprisingly active. According to recent research, sleep helps keep your brain clean by removing toxins that accumulate while you're awake.What happens to neurons during sleep?It specifically enables the reorganization of your neurons, or nerve cells. The glymphatic system in your brain, which removes waste from the central nervous system, operates while you sleep. Your brain is cleansed of poisonous wastes that accumulate throughout the day. This enables your brain to function well when you awaken.

To learn more about neural activity during sleep visit:

https://brainly.com/question/15398955

#SPJ4

Which virus has been implicated in adult gastroenteritis resulting from ingestion of contaminated food (especially shellfish) and water?

Answers

Answer:

diabetes effect if drink coeffe or tea

What is the cost for a counseling appointment at the counseling and mental health center (cmhc)?

Answers

The cost for a counseling appointment at the counseling and mental health center (cmhc) is "included with tuition and fees."

What is community mental health centre?

To address the demands for mental health care across the nation, community-based mental-health centers are essential.

Community mental health clinics fill the gaps left by people who are unable to receive treatment from private physicians by assisting those who are dealing with mental health issues.

The following are a few examples of the particular services they might provide to people with mental illness:

diagnostic assessmentscreening to see if someone should be admitted to a facility for mental healthemergency servicesServices for crisis interventionPsychotherapyDaycare or partial hospitalizationmental health and social servicesmedication administrationTreatment for substance abuse

Community mental health facilities are crucial in ensuring that people receive the mental care they require to live normal lives.

To know more about community mental health care programs, here

https://brainly.com/question/20709788

#SPJ4

What happens when you sharpen colored pencils too many times and you get a welt on your finger

Answers

A welt is formed on the finger due to excessive force generated on it.

What is a welt and why it is formed?

A welt is a lump of dead skin formed in that area. It is also known as a callus. When a person sharpens the pencil too many times, pressure and friction are generated on the skin of the fingers because of the pencils rubbing against the fingers. So as to protect the skin underneath which is very sensitive this dead mass is collected on the fingers as a welt.

They are the body’s way to protect itself naturally so they are not dangerous or harmful. They get healed by themselves automatically.

To read more about welt or callus visit here:

https://brainly.com/question/8870140

#SPJ4

Discuss the various issues that should be considered by a healthcare organization when defining the legal health record.

Answers

Healthcare organizations should take the following into account when defining the legal health record:

The EHR system's offered features that might produce pertinent information like does the EHR, for instance, offer patient portals, digital picture input, or clinical decision support? The health record's necessary retention time and the expense of storage. For instance, how much does storage cost?The significance of the data for future usage. Organizations should outline, for instance, how to distinguish between various categories of raw data. Whether all elements of the legal health record can be provided in readable electronic and paper form by the EHR system.What is Legal Health Record?For the aim of providing evidence, the legal health record serves to specify what details make up an organization's official business records. The patient database as a whole is broken down into the legal health record.

Learn more about legal health record here:

https://brainly.com/question/14832378

#SPJ4

Explain how the united states has both market and social justice aspects of health care

Answers

According to the concept of market justice, in a free market economy, market forces can lead to a fair allocation of healthcare among people who are free to choose the medical services they value.

In a just market, access to healthcare is determined by how willing and able individuals are to pay for it.To maintain social cohesion, social justice places a strong emphasis on treating all members of society equally, including the rich and the poor. Contrarily, market justice places a strong emphasis on ensuring that each person taking part in the exchange of goods and services has an equal opportunity to prosper.Delivering top-notch care to everyone is what social justice in healthcare means. To ensure that everyone can keep their health, achieving social justice in the field of health care is essential.

learn more about market justice here: https://brainly.com/question/18228641

#SPJ4

After working all afternoon cleaning up the attic, mr. Dixon is very thirsty and drinks a big glass of orange juice. His motivation to drink in order to reduce his feeling of thirst can best be explained by.

Answers

Drive theories

Drives include things like a need for warmth, to eat, or to be thirsty. Drive produces a bad mood and tension that needs to be relieved. Both people and animals look for ways to ease this tension and impelled the organism into activity to procure a reward that reduce the drive and satisfy it's related physiological need.

What is Drive theory ?

A drive theory, theory of drives, or drive doctrine is a theory in psychology that aims to describe, categorise, or explain the psychological urges.

An instinctive urge known as a drive—also known as a "excitatory state induced by a homeostatic disturbance"—can influence an individual's behaviour.

The idea, in its most basic version, held that no learning took place until a drive created tension and motivated the organism to engage in action in order to obtain a reward that would lessen the drive and meet its associated physiological need.

Learn more about Drive theory here:

https://brainly.com/question/4202212

#SPJ4

Our decisions on health products and health procedures are __________.
A.
affected by several external factors
B.
made without any information or influence
C.
not affected by the media
D.
only based on facts

Answers

Answer:

Affected by several external factors

Option: A

Trying to restrain someone who is having a seizure may cause her/him to become combative. True or false?.

Answers

Answer:

False because they do not have proper control of their movements

Explanation:

You must absolutely not: Hold the person down or attempt to restrain them in any way; this is very dangerous for everyone involved, as a person experiencing a seizure cannot control their movements

The average daily loss of water via the kidneys, lungs, feces, and skin is approximately:_____.

Answers

Mature adults lose about 2.5 to 3 liters of water per day.

In humans the average water loss by diffusion through the skin is about 300 to 400 ml/day, and an approximately equal amount is lost through the respiratory tract. The combined total of 600–800 ml/day represents 30–50% of all water loss, depending on the level of water intake.

The kidneys can remove 20–28 liters of water per day, but they cannot excrete more than 0.8 to 1.0 liters per hour. Drinking more than this can be harmful. Obligatory urine volume is limited by the concentrating power of the kidneys, but it can vary from 250 to 1400 ml per day depending on diet. Urine volume is usually 700 ml per day, but a high-protein diet demands more obligatory water to excrete the osmotically active products of protein metabolism.

To learn more about water loss , here

https://brainly.com/question/23435558

#SPJ4

If a woman gains 30 pounds during pregnancy, the net amount of body fat she gains is about _____.

Answers

If a woman gains 30 pounds during pregnancy, the net amount of body fat she gains is about 7 pound. Mostly women's gain somewhere between 25 and 35 pounds .

Mostly 2 to 4 pounds weight is gain during first trimester and then  1 to 2 pound a week for the rest of the entire pregnancy. According to DRIs during pregnancy women's do not need additional calories in their diet until the second trimester, after that 300 to 320 cal/day is recommended .

Increases of folic acid for women's who wish to became pregnant. If she carries more than one then she likely to be gain more weight. Being overweight before pregnancy increases the risk of pregnancy compilations such as high blood pressure , Precambrian and premature birth also c-section needed

To learn more about folic acid here

https://brainly.com/question/16816715

#SPJ4

What is the title of the appendix that helps you when a specific anatomical site is documented and the body part components are not as specific?

Answers

Appendix that helps you when a specific anatomical site is documented and the body part components are not as specific is appendix C.

Appendix C: Body Part Key

The ICD-10-PCS Index includes entries based on both entries based on common procedure words and entries based on terms (also known as values) used in the ICD-10-PCS Tables. Index entries could guide the user to another index entry or link directly to a PCS table.The ICD-10-PCS Definitions provide further explanation or examples in addition to the official definitions for the ICD-10-PCS values found in characters 3 through 7 of the seven-character code. The definitions are listed in alphabetical order per section, and they identify both the section and the character that is being described.A common anatomical phrase is linked to its matching ICD-10-PCS body part value in the ICD-10-PCS Body Part Key entries (s).The ICD-10-PCS Device Key includes entries that correspond to generic device terms or specific device names from manufacturers.

learn more about  appendix C here: https://brainly.com/question/26972624

#SPJ4

Commitment to a set of values that guide one's actions is indicative of the _____ dimension of health.

Answers

Commitment to a set of values that guide one's actions is indicative of the spiritual dimension of health.

What is spiritual health?

Spiritual health entails living a meaningful life, transcending and actualizing the multidimensional nature and abilities of human beings.

Spiritual health brings the physical, psychological, and social aspects of human life into balance.

Spiritual wellness recognizes our quest for profound meaning in life. We have a stronger connection to those around us and to a higher power when we are spiritually healthy.

Thus, dedication to a set of values that instruct one's actions is a sign of spiritual health.

For more details regarding spiritual health, visit:

https://brainly.com/question/1312932

#SPJ4

Which emergency drill is most useful when planning for a tornado? put on dry clothes. check for injuries. evacuate outdoors. stop, drop, and roll.

Answers

Answer:

(B) Check for injuries

Explanation:

In most national health care systems, total expenditures are controlled mainly through?

Answers

In most national health care systems, total expenditures are controlled mainly through? Supply-side rationing

What is supply-side rationing?

Provide-side rationing Also known as planned rationing since the government actively works to restrict access to healthcare services, especially those that go beyond the most basic level of care, when resources are scarce. Insurance companies may restrict access to care as a cost-cutting tactic, in part for the benefit of society, but also to protect profits, boost employee compensation, or for other objectionable motives. Some of their rationing does prevent premiums from increasing further, and it also enables insurers to continue operating.

To learn more about supply-side rationing from the given link:

https://brainly.com/question/10288659

#SPJ4

An infant with a total blood volume of 800 ml would start showing signs of shock when as little as________.

Answers

A child with a total blood volume of 800 ml would begin to show signs of shock when excessive tiredness and dizziness, nausea and vomiting, very pale and cold skin, confusion, bluish fingers and lips, and feeling faint.

What are the signs of blood loss shock?

Symptoms of hemorrhagic shock vary with the intensity of blood loss and range from mild initially, such as

headachefatiguenauseaheavy sweatingand dizziness

to extremely severe or lethal:

palecold, or clammy skin rapid and shallow breathing tachycardiaurine

With this information, we can conclude that The state of shock happens due to the lack or insufficiency of oxygen in the cells, caused by the deficiency of blood circulation.

Learn more about hemorrhagic shock  in brainly.com/question/25645645

#SPJ1

Why does the heart automatically adjust the flow of blood to match activity levels?
A.
Extreme activity damages blood cells and the body needs replacements.
B.
The heart requires more oxygen when exercising.
C.
It reduces the level of oxygen in the blood.
D.
Organs and muscles require more blood under stress.

Answers

Answer:

The heart automatically adjusts the blood flow because organs and muscles require more blood under stress.

Option D

The basic ingredients for pie dough are flour,_____, water and salt.
a) sugar
b) fat
c) butter
d) milk

Answers

the answer is a fat

What observation did somner make from the survey data of night blind children in indonesia?

Answers

The  observation Somner make from the survey data of night blind children in Indonesia is that  children with "mild" xerophthalmia (night blindness, Bitot's spots) died at far higher rates than their nonxerophthalmic peers.

Xerophthalmia ("xērós" meaning "dry" and "ophthalmos" meaning "eye") is a medical condition in which the eye fails to produce tears. It may be caused by vitamin A deficiency, which is sometimes used to describe that condition, although there may be other causes.

The damage to the cornea in vitamin A associated xerophthalmia is quite different from damage to the retina at the back of the globe, a type of damage which can also be due to lack of vitamin A, but which is caused by lack of other forms of vitamin A which work in the visual system. Xerophthalmia from hypovitaminosis A is specifically due to lack of the hormone-like vitamin A metabolite retinoic acid, since (along with certain growth-stunting effects) the condition can be reversed in vitamin A deficient rats by retinoic acid supplementation.(however the retinal damage continues)

Cause :

The condition is not congenital and develops over the course of a few months as the lacrimal glands fail to produce tears. Other conditions involved in the progression already stated include the appearance of Bitot's spots, which are clumps of keratin debris that build up inside the conjunctiva and night blindness, which precedes corneal ulceration and total blindness.

Treatment :

Treatment can occur in two ways: treating symptoms and treating the deficiency. Treatment of symptoms usually includes the use of artificial tears in the form of eye drops, increasing the humidity of the environment with humidifiers, and wearing wraparound glasses when outdoors. Treatment of the deficiency can be accomplished with a Vitamin A or multivitamin supplement or by eating foods rich in Vitamin A. Treatment with supplements and/or diet can be successful until the disease progresses as far as corneal ulceration, at which point only an extreme surgery can offer a chance of returning sight.

To learn more about xerophthalmia : https://brainly.com/question/11084478

#SPJ4

Jane is thirsty and wants to keep her beverage nearby. where and how can she best store this?

Answers

Jane is thirsty and wants to keep her drink close by. She can better store her drink with a bottle holder bag, and stay hydrated.

What is hydration?

Hydration is nothing more than the replacement of water in the body, balancing body composition. It represents between 50 and 65% of our body and is essential for the proper functioning of our system, including the skin.

Why is the hydration important?

Drinking enough water each day is crucial for many reasons: to regulate body temperature, keep joints lubricated, prevent infections, deliver nutrients to cells, and keep organs functioning properly. Being well-hydrated also improves sleep quality, cognition, and mood.

With this information, we can conclude that She can better store her drink with a bottle holder bag, and stay hydrated.

Learn more about Hydration  in brainly.com/question/1407849

#SPJ1

According to the cross-bridge model of muscle contraction, the muscles stiffen after death because atp is unavailable to bind and directly release?

Answers

According to the cross-bridge model of muscle contraction, the muscles stiffen after death because ATP cannot bind and directly release the myosin head from the actin filament.

What is myosin?

Myosin and actin are two essential proteins in muscle cells that interact during muscle contraction.

Adenosin Triphosphate (ATP) is a key high-energy molecule required during muscle contraction that binds to myosin and whose hydrolysis enables to produce movement.

In conclusion, according to the cross-bridge model of muscle contraction, the muscles stiffen after death because ATP cannot bind and directly release the myosin head from the actin filament.

Learn more about myosin and actin here:

https://brainly.com/question/23185374

#SPJ1

Which principle supports the justification of withholding or withdrawing life-sustaining measures?

Answers

Nonmaleficence, principle supports the justification of withholding or withdrawing life-sustaining measures

According to the nonmaleficence principle, it is wrong to cause harm to other people. It has a strong connection to the adage primum non nocere (first do no harm). The abovementioned rules are supported by the nonmaleficence principle.

To be non-maleficent, a nurse must never willfully cause injury. As it relates to medical competence, nurses are required to deliver a level of care that avoids or minimizes risk. Nurses can illustrate this idea by refraining from giving a patient subpar care. Non-maleficence serves as a gentle reminder that the goal of any action is to avoid causing harm. Being charitable encourages actions that will benefit others.

To learn more about non-maleficent  please visit -
https://brainly.com/question/14786401
#SPJ4

Question 25 of 40
After sanitizing, dishes must be
O
O
towel dried
air dried
either towel dried or air dried

Answers

Answer:

either towel dried or air dried

Maryanne has experienced difficulties throughout her pregnancy. the fetus is approaching the age of viability. how far along is maryanne’s pregnancy?

Answers

The fetus is approaching the age of viability means Maryanne is 23-24 weeks along pregnancy.

The capacity of a human fetus to survive outside the uterus is known as fetal viability.Typically, a pregnancy must be between 23 and 24 weeks gestational age to be deemed medically viable. Birth weight, gestational age, and access to high-quality medical care are just a few examples of the variables that affect viability. Due to a lack of access to healthcare, half of newborns delivered at or below 32 weeks gestational age in low-income countries died; in high-income nations, the vast majority of children born at or after 24 weeks gestational age lived. It refers to the stage of development when a fetus can survive outside the womb. There isn't a unanimous agreement that it is between 23 and 24 weeks, and some hospitals will aggressively treat and resuscitate newborns that are born in the 22nd week.

learn more about  fetal viability here: https://brainly.com/question/5783637

#SPJ4

Write a paragraph about the importance of getting a flu shot

Answers

The importance of getting a flu shot one can lower the risk of flu-linked hospitalization.

What is the importance of flu shot?

Flu vaccination is known to be a factor that tends to lower the risk that is known to  be linked with flu-associated kind of hospitalization.

Note that there are a lot of  Flu vaccination that is known to have prevented a lot of  thousands and millions of hospitalizations every year.

An example was the vaccination in  2019-2020 which was known to have prevented about an approximate  105,000 flu-linked hospitalizations.

Therefore, Is it necessary to get flu shot because if people between the aged of 6 months and older are vaccinated for annual flu vaccination, they can be excepted from some common sicknesses.

Hence, The importance of getting a flu shot one can lower the risk of flu-linked hospitalization.

Learn more about flu shot from

https://brainly.com/question/14909345

#SPJ1

A healthcare professional cares for older adults in a skilled nursing facility. what should the professional assess for in these individuals related to cardiovascular functioning?

Answers

A healthcare professional cares for older adults in a skilled nursing facility. The professional should assess for in these individuals related to cardiac functioning are Increased rate of falling and dizzy spells.

The Skilled Nursing Facility Cardiac Care Paradigm was created to help people understand how the present cardiac rehabilitation model fits with the cardiac care provided to SNF patients. Acute inpatient cardiac rehabilitation services are currently available.

Cardiovascular rehabilitation methods have been proven to help patients in an inpatient setting, such an SNF. Illness severity, cognitive status, physical function, depression, pain, complications, comorbidity, and social support are patient characteristics associated to successful rehabilitation and discharge home because these characteristics affect rehabilitation success.

Learn more about cardiac rehabilitation here:

https://brainly.com/question/15649629

#SPJ4

Other Questions
Estimate 50 to the hundredths place. A regular octagon has side lengths of 8 centimeters. what is the approximate area of the octagon? A state possesses secure second strike capabilities when all of its nuclear weapons can be destroyed in an initial preemptive strike by an adversary. True or false?. Based on neldas adieu which of neldas character traits is portrayed most Which of the following accesses a local variable var in structure fred?A. fred->var;B. fred.var;C. fred-var;D. fred>var; What is the slope?What is the slope?What is the slope?What is the slope?What is the slope? Random urinalysis testing is required to be conducted at what minimum time interval? How long should a person wash their hands for in order to help stop the spread of germs?. help me with this.Calculate angles in a triangle ________ is another word for ethnocentrism. multiple choice geocentrism ecocentrism This is for bio , translation and transcription genetics labelling help me pls Why did liechtenstein not attend the first meeting of the international confederation of wizards. When the number of members is too large for effective discussion, one strategy is to form subgroups called ____________ to simultaneously address an issue and then report back to the group at large. A company with high ebit is considering pursuing multiple projects next year. which trade-off is involved, and what is the ideal credit rating for the company between aaa, aa, a, and bbb? In the movie Lone star:Compare and contrast Buddy and Sam, Mercedez and Pilar, and Otis and Delmore's relationships: similarities and differences. Accenture has engaged with a new financial client who is looking for a comprehensive, company-wide security solution, and has operations in europe. when designing the clients solution, what should be prioritized between confidentiality, integrity, and availability (cia)? A disorganized attached child is likely to display what characteristics later in life? An example of a rock whose minerals have been crushed into thin sheets or bands graph: g(x)=5cos((\pi )/(2)x-(3\pi )/(2))-2 A(n) ________ is one in which energy moves freely in and out, but no matter enters or leaves the system.