Answer:
biological, chemical and physical.
Answer:
biological, chemical and physical.
Explanation:
Lilah is babysitting when baby cole starts choking on something. what is wrong with how lilah has positioned cole to dislodge the object?
Cole needs to be lying face down on Lilah's leg to dislodge the object.
Lilah is able to stop Cole from choking or engaging in amusing behavior by putting his face in her leg. Cole might also fall asleep as a result of it.
What are the signs of choking?Speech impairmentUnconsciousnessDarkening of the lipsDifficulties breathingWhat steps to take when baby starts choking?1. Acknowledge that the airway is blocked
2. Arms supporting the head in a down position.
3. Kneel down and give five back slaps.
4. While facing up, perform five chest compressions.
5. Repetition, switching between steps 3 and 4.
If LOC evaluate for and start CPR.
Learn more about choking here:
https://brainly.com/question/1723594
#SPJ4
Answer:
Lilah should have Cole face down over her leg.
Explanation:
What is the emerging disease with signs and symptoms of vomiting, diarrhea, fever, pain, and headache, and internal and external bleeding?
Ebola virus disease is the emerging disease with signs and symptoms of vomiting, diarrhea, fever, pain, and headache, and internal and external bleeding
The Ebola virus sickness is a serious and frequently fatal illness brought on by Ebola viruses. Up to 90% of cases during EVD outbreaks end in death. Hemorrhagic fever is a disorder that can be caused by other viruses as well, but Ebola viruses produce one of the most deadly versions.
The more severe forms of hemorrhagic fever can also result in blood vessel destruction and significant external bleeding in addition to the other symptoms of the condition, which include include fever, headache, muscle pain, weakness, vomiting, and diarrhoea (hemorrhage). The mortality rate for EVD can range from 25% to 90%.
Although novel therapies and vaccines are being investigated, there are currently no approved medications or vaccines to treat EVD.
Learn more about ebola virus here;
https://brainly.com/question/836713
#SPJ4
How does hunger and appetite differ in the way they influence our desire to eat?
Hunger is controlled by internal body mechanisms regulated by internal cues whereas appetite is controlled by external food choice mechanisms such as environmental.
Hunger is physiological. It occurs because of biological changes throughout the body, which signal that you need to eat to maintain energy levels.
Appetite is simply the desire to eat. It can be a result of hunger, but often has other causes, such as emotional or environmental conditions. It can also be a learned behavior.
For example, feeling very stressed, upset, or bored can increase appetite even when you aren’t really hungry.
To learn more about Hunger and Appetite, here
brainly.com/question/2929541
#SPJ4
What are the rules dealing with the deductibility of the cost of meals while away from home in order to receive medical treatment as an outpatient?
What are the rules dealing with the deductibility of the cost of meals while away from home in order to receive medical treatment as an outpatient?
Meals are typically not deductible for patients who are undergoing outpatient care while away from home.
What is outpatient?A patient who doesn't stay the night but attends a hospital for a diagnostic or treatment. Occasionally known as a day patient.
The area of a hospital designated for the care of outpatients, or people with health issues who visit the facility for diagnosis or treatment but do not currently need a bed or to be admitted for overnight care, is known as an outpatient department or outpatient clinic. Modern outpatient clinics provide a variety of medical treatments, diagnostic testing, and non-invasive surgeries.
To learn more about outpatient from given link:
https://brainly.com/question/22599476
#SPJ4
Which abbreviation refers to an inflammation that affects the middle ear, primarily in children?
An increase in which factor causes urinary frequency in the first trimester of pregnancy?
An increase in which factor causes urinary frequency in the first trimester of pregnancy?
The bladder experiences increased pressure from the uterus.
What is urinary frequency?In a 24-hour period, 6 to 7 urinations per day are considered normal for most people. If a person uses the restroom between 4 and 10 times a day and is healthy and content with this frequency, this is also considered to be normal.
Normal urine frequency is also influenced by the quantity and type of fluids you consume each day. Because of the way some medications function, such as "Diuretics," your blood pressure may rise if you take medication for high blood pressure, for instance. Your age and level of health and activity can also play a role; for example, children may urinate more frequently than adults do on average.
To learn more about urinary frequency from the given link:
https://brainly.com/question/13031653
#SPJ4
Equipment food-contact surfaces used with potentially harzardous food must be cleaned throughout the day at least every __________ hours.
Equipment food-contact surfaces used with potentially hazardous food must be cleaned throughout the day at least every 4 hours.
Equipment and utensils used for any potentially hazardous foods must have their food surfaces cleaned at least every four hours. Additionally, it must be cleaned when while working with ready-to-eat foods instead than raw food preparation or when switching to a different kind of raw animal food at work from the previous one. When using potentially dangerous items, such as uncooked animal products with raw fruits and vegetables equipment and utensils must be cleaned.
If the potentially dangerous food is kept at a specified temperature and stored, ( that are less than 40 °F or higher than 135 °F) equipment and utensils with food contact surfaces must be cleaned less frequently than every four hours, but at least once every day or when utensils are empty.
To learn more about food-contact surfaces, hazardous food and utensils here,
https://brainly.com/question/28000353
#SPJ4
As your skeletal muscles contract during physical activity, more blood is returned to the heart. which variable would be affected and what would be the outcome of this action?
A greater cardiac output would arise from an increase in preload.
What is cardiac output?Cardiac output, which is calculated as the sum of stroke volume and heart rate and expressed in liters per minute. The most typical definition of HR is how many times it beats in a minute. SV is the amount of blood expelled during each heartbeat or ventricular contraction.Cardiac output, which is determined by the heart's pace, contractility, preload, and afterload, is the volume of blood it can pump in a minute.When evaluating cardiac output values, it's crucial to comprehend how each of these four components applies and how it relates to everyday life.When a person is at rest, a healthy heart with a normal cardiac output pumps 5 to 6 litres of blood every minute.The volume of blood that the heart circulates across the body in a minute. The stroke volume refers to the volume of blood that the left ventricle of the heart pumps during a single contraction. The cardiac output is determined by the heart rate and stroke volume.
Learn more about cardiac output here:
https://brainly.com/question/1050328
#SPJ4
The correct spelling of the medical term that indicates forward movement in the gastrointestinal tract is ______________.
what is the function of vaccination
Answer:
To understand how vaccines work, it helps to first look at how the body fights illness. When germs, such as bacteria or viruses, invade the body, they attack and multiply. This invasion, called an infection, is what causes disease. The immune system uses your white blood cells to fight infection.
Explanation:
How Vaccines Work
Vaccines can help protect against certain diseases by imitating an infection. This type of imitation infection, helps teach the immune system how to fight off a future infection. Sometimes, after getting a vaccine, the imitation infection can cause minor symptoms, such as fever. Such minor symptoms are normal and should be expected as the body builds immunity.
Once the vaccinated body is left with a supply of T-lymphocytes and B-lymphocytes that will remember how to fight that disease. However, it typically takes a few weeks for the body to produce T-lymphocytes and B-lymphocytes after vaccination. Therefore, it is possible that a person infected with a disease just before or just after vaccination could develop symptoms and get that disease, because the vaccine has not had enough time to provide protection. While vaccines are the safest way to protect a person from a disease, no vaccine is perfect. It is possible to get a disease even when vaccinated, but the person is less likely to become seriously ill.
types of vaccine:
Live, attenuated vaccinesToxoid vaccines Non-live vaccinesAnswer:
Vaccination helps the body's immune system to build a defense mechanism to guard against the diseases.
Hope its helpful :-)
Oxidation of ______ contributes to plaque formation in the development of atherosclerosis.
Oxidation of LDL contributes to plaque formation in the development of atherosclerosis.
The "bad cholesterol" transporter LDL is clinically linked to atherosclerosis and high LDL levels.Chylomicrons, LDL, and VLDL levels that are higher are linked to atherosclerosis.Your blood vessels become clogged with plaque as a result of high cholesterol.Atherosclerosis is the medical term for this plaque buildup. Atherosclerosis increases the likelihood of developing a wide range of illnesses.LDL-loaded macrophages grow into foam cells, which encourage inflammation and accelerate atherosclerotic plaque development.The plaques can become unstable and restrict the artery. A ruptured plaque can trigger blood clotting, obstruct blood flow to the brain or heart, and cause a heart attack or stroke.
learn more about atherosclerosis here:
brainly.com/question/4142223
#SPJ4
Which is not a developmental task of adolescence? select one:
a. starting a vocation or career
b. becoming emotionally independent
c. developing personal values
d. learning to control behavior
Answer:
b is the correct answer
Explanation:
if u need more info on how to back it up let me know ill be glad to
The sensory component of pain is to _____ as the emotional component of pain is to _____
The sensory component of pain is to throbbing as the emotional component of pain is too annoying.
In general, pain has 2 components
1) Sensory
2) Emotional
The sensory component of pain is to throbbing as the emotional component of pain is too annoying.
Pain is a modality of protection, whereas the majority of sensory and somatosensory modalities are primarily informational.
Because pain is both a discriminative sensation and a graded emotional experience connected to existing or potential tissue damage, it varies from the classical senses (hearing, smell, taste, touch, and vision).
A sub modality of somatic sense is pain. A wide variety of unpleasant sensory and mental sensations connected to existing or potential tissue injury are referred to as "pain."
Learn more about pain here https://brainly.com/question/15073046
#SPJ4
List five ways to incorporate safety while being active and tell why each is important.
Why is it important to have safety while doing physical activity?
Overview. Practicing exercise safety helps optimize the health benefits of a fitness routine. When planning an exercise program, it's important to consider factors such as age and health history as well as personal strength and stamina. Five ways to incorporate safety while being active -Use safety equipment.Warm up to your workout. Drink plenty of fluids when you are physically active, even if you are not thirsty.Always bend forward from the hips, not the waist. Stop being active if you feel very out of breath, dizzy, or nauseated or have pain.Learn more about being active
brainly.com/question/8475261
#SPJ4
A Possible prevention of osteoporosis is
increasing vitamin D levels within the body.
increasing calcium and magnesium within the body.
taking anti-inflammatory drugs to reduce swelling.
correcting poor posture habits.
Answer:
Diet, vitamin D and weight-bearing exercise can help to prevent osteoporosis. If you have osteoporosis, medical treatment can prevent further bone loss and reduce your risk of bone fractures.
Explanation:
Correct Answer:
increasing calcium and magnesium
Explanation:
yes.
What would be the best advice to give someone who wants to retain good cognitive functioning?
Answer: Exercise your body and your mind, use it or lose it.
Illness is considered a behavioral stressor.
Please select the best answer from the choices provided.
T
F
Answer: false
Explanation:
because it can be an allergy
At home, a _____ is the best substitute for a laboratory safety shower. watering can bottle of water kitchen faucet bathroom shower
At home, a bathroom shower is the best substitute for a laboratory safety shower.
There are Standard for laboratory safety showers or emergency showers and eyewash equipment design, performance, use, and maintenance. A minimum water flow of 20 gallons (76 litres) per minute must be available for at least 15 minutes in an emergency safety shower. For 15 minutes, 0.4 gallons (1.5 litres) of water must flow at a minimum flow rate for eye washes. If the device is an eye and face wash in one, it needs to pump out 3 gallons (11.3 litres) of water every minute.
Thus laboratory safety showers ensures that there is enough water to dilute and flush away the chemical while preventing injury to the skin or eyes from excessive water velocity.
To learn more about laboratory safety showers click here
brainly.com/question/21292365
#SPJ4
In a disease, a(n) ______ mutation causes the dna sequence aga which encodes the mrna codon ucu and specifies arginine to change to agc that encodes ucg in the mrna and specifies serine.
Answer:missense mutation
Explanation:
At what height does a fall become severe enough for an adult to necessitate trauma services based solely on the mechanism of injury?
Answer:
height 20 ft.
When a preschool-age child is developing a gender schema, she or he is __________.
When a preschool-age child is developing a gender schema, she or he is Using one's own cognitive skills to create "rules" about what is appropriate and inappropriate for males and females.
The psychologist Sandra Bem developed the gender schema hypothesis in 1981, which claimed that children pick up on male and female roles from the culture in which they are raised. The hypothesis contends that from the earliest stages of social development, kids modify their conduct to conform to the gender standards of their culture.
The cognitive revolution and Bem's aim to address what she saw as flaws in the psychoanalytic and social learning theories of the day both had an impact on her theory.
To learn more about gender schema click here
brainly.com/question/7277651
#SPJ4
In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except ________.
production of energy
In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except production of energy.
What is meant by balanced diet?A balanced diet is one that includes a variety of foods in the right amounts and ratios so that the body receives the proper amount of calories, proteins, minerals, vitamins, and other nutrients. A small portion of the diet is also set aside for extra nutrients to help the body maintain its lean state during the brief period of time when it is required to be lean.What are the essential seven ingredients for a healthy diet?It should be simpler to enjoy food and maintain good health if you have an understanding of the balance in your diet. Seven components are necessary for a balanced diet: water, carbohydrates, protein, fat, and fiberWhy is a balanced diet so crucial?You are shielded from a variety of degenerative noncommunicable diseases, including cancer, diabetes, and heart disease. A balanced diet that limits salt, sugar, saturated fats, and trans fats from industrial production is crucial for good health.To learn more about diet visit:
https://brainly.com/question/24351545
#SPJ4
The methods for collecting, compiling, and presenting health information is called?
Answer:
health communications
Explanation:
methods for collecting, compiling, and presenting health information
-how we perceive info, combine info, and use info to make decisions
- health comm. is about info, from its collection to its use
What do early-onset alzheimer disease and huntington disease have in common?
Answer:
Alzheimer and Huntington disease both share a abnormal protein that attacks brain cells causing memory loss and other
Explanation:
Why is it important to dress in layers during the winter?
Layers of clothing keep you dry.
Layers of clothing trap your body's heat.
Layers of clothing help prevent frostbite and hypothermia.
all of the above
After a recent fall by a resident, the nursing assistant is currently completing an incident (occurrence) report. The primary purpose of completing an incident (occurrence) report is it?
The primary purpose of completing an incident (occurrence) report is to make improvements in future safety.
What is incident (occurrence) report?An incident (occurrence) report is a type of report usually written by health professional that provides a factual description of an adverse event.
There are different types of incidence (occurrence) report which include the following:
Near Miss Reports. Injury and Lost Time Incident Report.Exposure Incident Report, and Sentinel Event Report.The type of incidence report that should be written by the nurse is an Injury and Lost Time Incident Report which can make improvements in future safety of the resident.
Learn more about injury here:
https://brainly.com/question/19573072
#SPJ1
The marshmallow task is a classic research experiment that demonstrates the importance of which concept?
Marshmallow task demonstrates the concept of delayed gratification.
What is the marshmallow test?The marshmallow test is a research method that gauges a child's capacity for delaying gratification. The youngster has the choice of waiting a little time to acquire their preferred treat or, if they choose not to wait, getting a less-desired treat. A child's capacity to postpone gratification is measured in the minutes or seconds they wait.
The original marshmallow experiment demonstrated that the experimental conditions, such as the actual presence or lack of anticipated sweets, had a major impact on preschoolers' delay durations.
One of the most well-known studies in social science is the marshmallow test: Give a youngster a marshmallow, tell her she can have another one if she can wait 15 minutes after finishing the first, and then leave the room. It is said that a person's ability to maintain their composure long enough to double their reward is a sign of future success at work and in school. Many people view passing the test as an indication of future success.
I understand the question you are looking for is this:
The marshmallow task is a classic research experiment that demonstrates the importance of which concept?
a). Achievement expectations
b). Delayed gratification
c). Sustained attention
d). Goal setting
Learn more about marshmallow task here:
https://brainly.com/question/6336969
#SPJ4
A client's most recent diagnostic imaging has revealed that lung cancer has metastasized to the bones and liver. what is the most likely mechanism by which the client's cancer cells spread?
Lymphatic circulation is the way by which the client's cancer cells spread to the bones and liver.
Small blood arteries can be used by cancer cells to enter the bloodstream. These cells are known as circulating tumor cells (or CTCs). to assist in cancer diagnosis and therapy vigilance. The cancer cells are carried by the moving blood until they become lodged.Once cancer cells have broken out from the initial tumor and are in the bloodstream, they circulate as single cells or cell clusters (sometimes referred to as CTCs) until they are stopped in the capillary beds that feed the following organ in the circulatory system and remove waste.The term "circulating tumor cells" (CTCs) refers to tumor cells that have exfoliated from the main tumor and extravasated into the bloodstream, where they circulate.learn more about cancer here: https://brainly.com/question/11710623
#SPJ4
Which finding is a sign of circulatory compromise caused by a significant burn injury?
Ileus is a sign of circulatory compromise caused by a significant burn injury. the correct answer is option(b).
An injury to the skin or other organic tissue known as a burn is one that is primarily brought on by heat, radiation, radioactivity, electricity, friction, or contact with chemicals.
Thermal (heat) burns happen when one or more of the following causes the skin's or other tissues' cells to die: (scalds)
Various burns include:
Mild first-degree burns (like most sunburns). Although the epidermis, the top layer of skin, often becomes red and uncomfortable, it rarely blisters.Skin's upper and lower layers (dermis) are affected by second-degree burns.The epidermis, dermis, and fat of the skin are all affected by third-degree burns.as paralytic ileus, a condition brought on by a decline in intestinal motility and integrity. During the first two days of hypovolemic shock, this happens. The first symptom of burns with a TBSA of more than 25% is gastroparesis, which can progress to clinical ileus in more severe cases.
Which finding is a sign of circulatory compromise caused by a significant burn injury?
A. Urine output of 1 mL/kg/hour
B. Ileus
C. Facial blisters
D. Cherry-red skin
To know more about burn injury refer to: https://brainly.com/question/14145208
#SPJ4
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation: