Answer:
Affected by several external factors
Option: A
The hpv vaccine is nearly 100ffective in preventing ___ strains of hpv that cause warts and cervical cancer
The HPV vaccine is nearly 100% effective in preventing type 16 and type 18 strains of HPV that cause warts and cervical cancer.
The HPV vaccine Gardasil 9 protects against infection from nine HPV types: the two low-risk HPV types that cause most genital warts, plus the seven high-risk HPV types that cause most HPV-related cancers.
Human Papilloma Virus or HPV-related cancers often take years to develop after getting an HPV infection.
HPV infects the squamous cells that line the inner surfaces of these organs. For this reason, most HPV-related cancers are a type of cancer called squamous cell carcinoma.
To learn more about HPV vaccine ,here
https://brainly.com/question/6985320
#SPJ4
In a disease, a(n) ______ mutation causes the dna sequence aga which encodes the mrna codon ucu and specifies arginine to change to agc that encodes ucg in the mrna and specifies serine.
Answer:missense mutation
Explanation:
In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except ________.
production of energy
In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except production of energy.
What is meant by balanced diet?A balanced diet is one that includes a variety of foods in the right amounts and ratios so that the body receives the proper amount of calories, proteins, minerals, vitamins, and other nutrients. A small portion of the diet is also set aside for extra nutrients to help the body maintain its lean state during the brief period of time when it is required to be lean.What are the essential seven ingredients for a healthy diet?It should be simpler to enjoy food and maintain good health if you have an understanding of the balance in your diet. Seven components are necessary for a balanced diet: water, carbohydrates, protein, fat, and fiberWhy is a balanced diet so crucial?You are shielded from a variety of degenerative noncommunicable diseases, including cancer, diabetes, and heart disease. A balanced diet that limits salt, sugar, saturated fats, and trans fats from industrial production is crucial for good health.To learn more about diet visit:
https://brainly.com/question/24351545
#SPJ4
What would be the best advice to give someone who wants to retain good cognitive functioning?
Answer: Exercise your body and your mind, use it or lose it.
Which is not a developmental task of adolescence? select one:
a. starting a vocation or career
b. becoming emotionally independent
c. developing personal values
d. learning to control behavior
Answer:
b is the correct answer
Explanation:
if u need more info on how to back it up let me know ill be glad to
Do you think your life could be improved by changing when or how long you sleep each day? in what ways? what negative effects do you think such changes might have on you?
Yes, definitely life can be improved by changing when and how much you sleep each day.
How much sleep is required for the proper functioning of the body?Sleep is a state of rest that is given to the body which has been continuously working for the entire day.
As per the doctors, 6-8 hours of sleep is important for the normal physiology of the body. It is important to sleep in the dark because darkness induces the production of the chemical melatonin in the body which is responsible for sleep. So, first, it is important to sleep in dark. The next important thing is that there is a circadian rhythm of the body or it can be called a biological clock, if that clock is synchronized with the natural clock then the body’s physiology works very well. So, it is very important to sleep early which is between 10-11 pm, and wake up early which is between 4-5 am.The above steps can be taken to improve the duration and timings of your sleep.
They don’t have any negative effects on the body, yes in the beginning your body will resist such changes but once you get habitual to it, you will feel the difference in the body’s physiology.
To know more about sleep visit here:
https://brainly.com/question/2064457
#SPJ4
When a preschool-age child is developing a gender schema, she or he is __________.
When a preschool-age child is developing a gender schema, she or he is Using one's own cognitive skills to create "rules" about what is appropriate and inappropriate for males and females.
The psychologist Sandra Bem developed the gender schema hypothesis in 1981, which claimed that children pick up on male and female roles from the culture in which they are raised. The hypothesis contends that from the earliest stages of social development, kids modify their conduct to conform to the gender standards of their culture.
The cognitive revolution and Bem's aim to address what she saw as flaws in the psychoanalytic and social learning theories of the day both had an impact on her theory.
To learn more about gender schema click here
brainly.com/question/7277651
#SPJ4
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
Which finding is a sign of circulatory compromise caused by a significant burn injury?
Ileus is a sign of circulatory compromise caused by a significant burn injury. the correct answer is option(b).
An injury to the skin or other organic tissue known as a burn is one that is primarily brought on by heat, radiation, radioactivity, electricity, friction, or contact with chemicals.
Thermal (heat) burns happen when one or more of the following causes the skin's or other tissues' cells to die: (scalds)
Various burns include:
Mild first-degree burns (like most sunburns). Although the epidermis, the top layer of skin, often becomes red and uncomfortable, it rarely blisters.Skin's upper and lower layers (dermis) are affected by second-degree burns.The epidermis, dermis, and fat of the skin are all affected by third-degree burns.as paralytic ileus, a condition brought on by a decline in intestinal motility and integrity. During the first two days of hypovolemic shock, this happens. The first symptom of burns with a TBSA of more than 25% is gastroparesis, which can progress to clinical ileus in more severe cases.
Which finding is a sign of circulatory compromise caused by a significant burn injury?
A. Urine output of 1 mL/kg/hour
B. Ileus
C. Facial blisters
D. Cherry-red skin
To know more about burn injury refer to: https://brainly.com/question/14145208
#SPJ4
How does hunger and appetite differ in the way they influence our desire to eat?
Hunger is controlled by internal body mechanisms regulated by internal cues whereas appetite is controlled by external food choice mechanisms such as environmental.
Hunger is physiological. It occurs because of biological changes throughout the body, which signal that you need to eat to maintain energy levels.
Appetite is simply the desire to eat. It can be a result of hunger, but often has other causes, such as emotional or environmental conditions. It can also be a learned behavior.
For example, feeling very stressed, upset, or bored can increase appetite even when you aren’t really hungry.
To learn more about Hunger and Appetite, here
brainly.com/question/2929541
#SPJ4
The marshmallow task is a classic research experiment that demonstrates the importance of which concept?
Marshmallow task demonstrates the concept of delayed gratification.
What is the marshmallow test?The marshmallow test is a research method that gauges a child's capacity for delaying gratification. The youngster has the choice of waiting a little time to acquire their preferred treat or, if they choose not to wait, getting a less-desired treat. A child's capacity to postpone gratification is measured in the minutes or seconds they wait.
The original marshmallow experiment demonstrated that the experimental conditions, such as the actual presence or lack of anticipated sweets, had a major impact on preschoolers' delay durations.
One of the most well-known studies in social science is the marshmallow test: Give a youngster a marshmallow, tell her she can have another one if she can wait 15 minutes after finishing the first, and then leave the room. It is said that a person's ability to maintain their composure long enough to double their reward is a sign of future success at work and in school. Many people view passing the test as an indication of future success.
I understand the question you are looking for is this:
The marshmallow task is a classic research experiment that demonstrates the importance of which concept?
a). Achievement expectations
b). Delayed gratification
c). Sustained attention
d). Goal setting
Learn more about marshmallow task here:
https://brainly.com/question/6336969
#SPJ4
A person who exhibits sudden paralysis while remaining conscious may be suffering from?
A person who exhibits sudden paralysis while remaining conscious may be suffering from an episode of cataplexy.
Cataplexy:
While a person is awake, cataplexy is an abrupt loss of muscle tone that causes weakness and a lack of voluntary muscle control. Strong, sudden emotions like laughter, anxiety, rage, tension, or excitement are frequently what set it off.
The reduction of muscular tone experienced during cataplexy is comparable to the natural paralysis of muscle activity experienced during REM sleep. At most a few minutes long, episodes end very immediately on their own. The episodes are frightening, but as long as the person finds a secure location to collapse, they are not harmful. While cataplexy happens once a person is completely awake, sleep paralysis occurs at the borders of sleep.
Learn more about paralysis here:
https://brainly.com/question/7249786
#SPJ4
Which individual is at an increased risk of dying in a famine, losing life to a wasting disease, and experiencing a poor outcome from surgery due to inadequate nutrient stores?
a person who is underweight is at an increased risk of dying in a famine, losing life to a wasting disease, and experiencing a poor outcome from surgery due to inadequate nutrient stores
A person is deemed to be underweight if their body weight is too low for them to be healthy. Animals are subject to the same principles. Underweight. The white area on the chart represents the body mass index (BMI) underweight range.
Using our BMI healthy weight calculator, which displays your body mass index, you can determine if you are underweight (BMI). Your weight can be too low if your BMI is less than 18.5. Inform your doctor or the practice nurse if you or someone you know is underweight.
To learn more about underweight please visit-
https://brainly.com/question/13106275
#SPJ4
Which goal of cancer treatment plan focuses on cancers that cannot be eradicated but are responsive for?
Palliation control is the goal of cancer treatment plan which focuses on cancers that cannot be eradicated but are responsive to anticancer therapies.
The treatment used to reduce symptoms or give relief is known as palliative care. For example, anti-nausea treatments or pain medicines are palliative and hence can be used at all stages of treatment.
It cannot be exactly told when chemotherapy is used as a palliative treatment since most often it is associated with curing or controlling the cancer. However, chemotherapy becomes part of a palliative care plan when it is deployed in order to provide comfort to the patient.
Chemotherapy can be used to reduce the size of a tumor which is generating pain to make the patient feel better and experience less pain.
To learn more about palliative care here
https://brainly.com/question/19580009
#SPJ4
Which antidepressant class is most closely linked with anticholinergic side effects?
Tricyclic antidepressant (TCAs) class is most closely linked with anticholinergic side effects.
Amitriptyline, amoxapine, clomipramine and protriptyline are Tricyclic antidepressants (TCAs) that are used to treat chronic pain. Amitriptyline and nortriptyline among these medications provide the most reassuring safety information during pregnancy and breastfeeding.
In vitro and in vivo, TCAs are powerful inhibitors of norepinephrine and/or serotonin reuptake. In addition, several TCAs are known to block sodium, calcium, alpha-1 adrenoceptors, histamine (H1) receptors, and muscarinic cholinergic receptors. Thought to be responsible for their unfavourable anticholinergic, antihistaminergic, and cardiotoxic side effects rather than their antidepressant effects, these neurotransmitter receptor actions.
Learn more about TCAs here;
https://brainly.com/question/9919675
#SPJ4
As your skeletal muscles contract during physical activity, more blood is returned to the heart. which variable would be affected and what would be the outcome of this action?
A greater cardiac output would arise from an increase in preload.
What is cardiac output?Cardiac output, which is calculated as the sum of stroke volume and heart rate and expressed in liters per minute. The most typical definition of HR is how many times it beats in a minute. SV is the amount of blood expelled during each heartbeat or ventricular contraction.Cardiac output, which is determined by the heart's pace, contractility, preload, and afterload, is the volume of blood it can pump in a minute.When evaluating cardiac output values, it's crucial to comprehend how each of these four components applies and how it relates to everyday life.When a person is at rest, a healthy heart with a normal cardiac output pumps 5 to 6 litres of blood every minute.The volume of blood that the heart circulates across the body in a minute. The stroke volume refers to the volume of blood that the left ventricle of the heart pumps during a single contraction. The cardiac output is determined by the heart rate and stroke volume.
Learn more about cardiac output here:
https://brainly.com/question/1050328
#SPJ4
The methods for collecting, compiling, and presenting health information is called?
Answer:
health communications
Explanation:
methods for collecting, compiling, and presenting health information
-how we perceive info, combine info, and use info to make decisions
- health comm. is about info, from its collection to its use
What do early-onset alzheimer disease and huntington disease have in common?
Answer:
Alzheimer and Huntington disease both share a abnormal protein that attacks brain cells causing memory loss and other
Explanation:
The sensory component of pain is to _____ as the emotional component of pain is to _____
The sensory component of pain is to throbbing as the emotional component of pain is too annoying.
In general, pain has 2 components
1) Sensory
2) Emotional
The sensory component of pain is to throbbing as the emotional component of pain is too annoying.
Pain is a modality of protection, whereas the majority of sensory and somatosensory modalities are primarily informational.
Because pain is both a discriminative sensation and a graded emotional experience connected to existing or potential tissue damage, it varies from the classical senses (hearing, smell, taste, touch, and vision).
A sub modality of somatic sense is pain. A wide variety of unpleasant sensory and mental sensations connected to existing or potential tissue injury are referred to as "pain."
Learn more about pain here https://brainly.com/question/15073046
#SPJ4
What purpose does a community health center serve in preventative and primary care?
Community health centres are outpatient clinics that provide primary care to a specific population, such as clients with young children or clients with diabetes.
Community health centres are designed to improve access to primary care services regardless of whether patients have insurance, speak languages other than English or Hindi, or live in remote areas.
These centres often target groups facing health disparities and limited care resources, including patients living in poverty, rural residents, veterans, and the homeless. Clinics typically use a sliding scale for fees and provide care even when patients cannot pay.
Typical services include:
Preventive and primary care services. (including medical and dental check-ups and condition management)Disease prevention. (vaccinations, anti-smoking programs, and obesity screenings)Patient education. (nutritional counselling, injury prevention, and disease information)Mental health services. (screenings and counselling)Substance abuse treatment.By providing comprehensive preventive care and helping patients monitor chronic conditions, community health centres serve to lower medical costs by reducing expensive emergency department visits and hospital stays. Many of these centres operate as patient-centred medical homes (PCMHs).
Most community health centres receive federal grant funding under the Health Centre Program, which aims to improve health care for vulnerable populations. Many community health centres also receive funding and operational support from state agencies and non-profit charitable organizations.
To learn more about community health centres : https://brainly.com/question/10620528
#SPJ4
A Possible prevention of osteoporosis is
increasing vitamin D levels within the body.
increasing calcium and magnesium within the body.
taking anti-inflammatory drugs to reduce swelling.
correcting poor posture habits.
Answer:
Diet, vitamin D and weight-bearing exercise can help to prevent osteoporosis. If you have osteoporosis, medical treatment can prevent further bone loss and reduce your risk of bone fractures.
Explanation:
Correct Answer:
increasing calcium and magnesium
Explanation:
yes.
After a recent fall by a resident, the nursing assistant is currently completing an incident (occurrence) report. The primary purpose of completing an incident (occurrence) report is it?
The primary purpose of completing an incident (occurrence) report is to make improvements in future safety.
What is incident (occurrence) report?An incident (occurrence) report is a type of report usually written by health professional that provides a factual description of an adverse event.
There are different types of incidence (occurrence) report which include the following:
Near Miss Reports. Injury and Lost Time Incident Report.Exposure Incident Report, and Sentinel Event Report.The type of incidence report that should be written by the nurse is an Injury and Lost Time Incident Report which can make improvements in future safety of the resident.
Learn more about injury here:
https://brainly.com/question/19573072
#SPJ1
Researchers have found no ________ differences between breast-fed infants and bottle-fed infants.
Researchers have found differences between breast-fed infants and bottle-fed infants because one natural and the other is artificial.
Which is better breast or bottle feeding?Health experts agree that breastfeeding is the healthiest option for both mother and baby because of the difference in weight gain, breast-fed infants are generally thinner and slim than bottle fed infants. Bottle milk has limited nutrients as compared to mother's milk which make significant increase in health of the child. Breast-fed infants appear to self-regulate their energy intake at a lower level as compared to bottle-fed infants that have a lower metabolic rate.
So we can conclude that researchers have found differences between breast-fed infants and bottle-fed infants because one natural and the other is artificial.
Learn more about infants here: https://brainly.com/question/24726649
#SPJ1
Applies to during the concrete operational stage, children learn that many transformations by which changes can be undone.
At this stage of development, children are still highly literal and concrete in their thinking, but they become much better at applying logic. Kids get better at considering how other people might see a situation as they progress through the stages, and the egocentrism of the earlier stage starts to fade.
What is concrete operational stage in child development ?Between the ages of 7 and 11 or 12, when a child is in the third stage, or the concrete operational stage, they start to think logically and start classifying objects based on their similarities and differences. The toddler also starts to understand the notions of time and number during this time.
According to Piaget, logical operations like conservation, reversibility, or classification, which enable logical reasoning, characterise thinking at this stage.Learn more about concrete operational stage here:
https://brainly.com/question/14655682
#SPJ4
The correct spelling of the medical term that indicates forward movement in the gastrointestinal tract is ______________.
At what height does a fall become severe enough for an adult to necessitate trauma services based solely on the mechanism of injury?
Answer:
height 20 ft.
The majority of studies conducted in athletes suggest that vitamin b12 injections boost red blood cell production.
a. true
b. false
The majority of research done on athletes indicate that vitamin B₁₂ injections increase the synthesis of red blood cells. Those claims are true.
Role of vitamin B₁₂:
Red blood cells, neurons, and DNA all require vitamin B12 for their creation and maintenance. Anemia, or a lack of red plasma cells, can result from inadequate vitamin B₁₂ intake and make you feel weak and exhausted. Your body's ability to hold onto oxygen and maintain endurance declines when you don't consume enough vitamin B₁₂ to produce red blood cells.Additionally, a vitamin B₁₂ deficiency might raise your risk of experiencing tingling and numbness of the skin, poor mental health, impaired cognitive function, and uncoordinated movements.According to some studies, athletes who do not get enough vitamin B₁₂in their diets may find it more difficult to engage in high-intensity activity. Higher vitamin B₁₂ levels are especially correlated with improved athletic performance in females. This is probably because vitamin B₁₂ helps the body regenerate tissues by repairing damaged cells and synthesizing new cells like red blood cells.Therefore it is concluded that the questioned statement is true.
Learn more about vitamin B₁₂ here:
https://brainly.com/question/8965798
#SPJ4
Which eye disorder can result from either an injury or infection and is treated with antibiotic eye drops and drops that temporarily paralyze the ciliary muscles to help control pain?
According to the research, the correct option is conjunctivitis, it is an eye disorder can result from either an injury or infection and is treated with antibiotic eye drops.
What is conjunctivitis?It is a frequent pathology that inflames the conjunctiva and is sometimes accompanied by significant edema of the eyelid, the infection being of viral or bacterial origin or can result from either an injury.
Generally, if it is of bacterial origin with purulent discharge, the doctor prescribes antibiotics, which are usually topical drops or ointment to help control pain.
Therefore, we can conclude that according to the research, the correct option is conjunctivitis, it is an eye disorder can result from either an injury or infection and is treated with antibiotic eye drops.
Learn more about conjunctivitis here: https://brainly.com/question/14938345
#SPJ1
An increase in which factor causes urinary frequency in the first trimester of pregnancy?
An increase in which factor causes urinary frequency in the first trimester of pregnancy?
The bladder experiences increased pressure from the uterus.
What is urinary frequency?In a 24-hour period, 6 to 7 urinations per day are considered normal for most people. If a person uses the restroom between 4 and 10 times a day and is healthy and content with this frequency, this is also considered to be normal.
Normal urine frequency is also influenced by the quantity and type of fluids you consume each day. Because of the way some medications function, such as "Diuretics," your blood pressure may rise if you take medication for high blood pressure, for instance. Your age and level of health and activity can also play a role; for example, children may urinate more frequently than adults do on average.
To learn more about urinary frequency from the given link:
https://brainly.com/question/13031653
#SPJ4
Equipment food-contact surfaces used with potentially harzardous food must be cleaned throughout the day at least every __________ hours.
Equipment food-contact surfaces used with potentially hazardous food must be cleaned throughout the day at least every 4 hours.
Equipment and utensils used for any potentially hazardous foods must have their food surfaces cleaned at least every four hours. Additionally, it must be cleaned when while working with ready-to-eat foods instead than raw food preparation or when switching to a different kind of raw animal food at work from the previous one. When using potentially dangerous items, such as uncooked animal products with raw fruits and vegetables equipment and utensils must be cleaned.
If the potentially dangerous food is kept at a specified temperature and stored, ( that are less than 40 °F or higher than 135 °F) equipment and utensils with food contact surfaces must be cleaned less frequently than every four hours, but at least once every day or when utensils are empty.
To learn more about food-contact surfaces, hazardous food and utensils here,
https://brainly.com/question/28000353
#SPJ4