Both mdma (or ecstasy) and pcp have recently been reclassified as ________ hallucinogenic drugs.

Answers

Answer 1

Both MDMA ( or Ecstasy) and PCP have recently been reclassified as recreational hallucinogenic drugs.

hallucinogenic drugs are a broad and diverse group of psychoactive substances that can induce altered states of consciousness marked by significant changes in thought, mood, and perception, among other things. Psychedelics, dissociatives, or deliriants are general categories that apply to most hallucinogens. Psychostimulants (such as cocaine or amphetamine), so-called "dissociative anesthetics" (such as PCP or ketamine), and psychedelics (such as lysergic diethylamide (LSD) and psilocybin) are at least three different types of medications that can cause hallucinations.

Recreational hallucinogenic drugs usage is defined as the use of one or more psychoactive drugs to affect the user's perceptions, sensations, and emotions in order to achieve a desired altered state of consciousness for pleasure or another non-essential goal or activity. These substances frequently used as examples include cocaine, morphine, marijuana, etc.

To know more about hallucinogenic drugs refer to:  https://brainly.com/question/3741568

#SPJ4


Related Questions

In a disease, a(n) ______ mutation causes the dna sequence aga which encodes the mrna codon ucu and specifies arginine to change to agc that encodes ucg in the mrna and specifies serine.

Answers

Answer:missense mutation

Explanation:

What would be the best advice to give someone who wants to retain good cognitive functioning?

Answers

Answer: Exercise your body and your mind, use it or lose it.

Which goal of cancer treatment plan focuses on cancers that cannot be eradicated but are responsive for?

Answers

Palliation control is the goal of cancer treatment plan which focuses on cancers that cannot be eradicated but are responsive to anticancer therapies.

The treatment used to reduce symptoms or give relief is known as palliative care. For example, anti-nausea treatments or pain medicines are palliative and hence can be used at all stages of treatment.

It cannot be exactly told when chemotherapy is used as a palliative treatment since most often it is associated with curing or controlling the cancer. However, chemotherapy becomes part of a palliative care plan when it is deployed in order to provide comfort to the patient.

Chemotherapy can be used to reduce the size of a tumor which is generating pain to make the patient feel better and experience less pain.

To learn more about palliative care here

https://brainly.com/question/19580009

#SPJ4

As your skeletal muscles contract during physical activity, more blood is returned to the heart. which variable would be affected and what would be the outcome of this action?

Answers

A greater cardiac output would arise from an increase in preload.

What is cardiac output?Cardiac output, which is calculated as the sum of stroke volume and heart rate and expressed in liters per minute. The most typical definition of HR is how many times it beats in a minute. SV is the amount of blood expelled during each heartbeat or ventricular contraction.Cardiac output, which is determined by the heart's pace, contractility, preload, and afterload, is the volume of blood it can pump in a minute.When evaluating cardiac output values, it's crucial to comprehend how each of these four components applies and how it relates to everyday life.When a person is at rest, a healthy heart with a normal cardiac output pumps 5 to 6 litres of blood every minute.The volume of blood that the heart circulates across the body in a minute. The stroke volume refers to the volume of blood that the left ventricle of the heart pumps during a single contraction. The cardiac output is determined by the heart rate and stroke volume.

Learn more about cardiac output here:

https://brainly.com/question/1050328

#SPJ4

Researchers have found no ________ differences between breast-fed infants and bottle-fed infants.

Answers

Researchers have found differences between breast-fed infants and bottle-fed infants because one natural and the other is artificial.

Which is better breast or bottle feeding?

Health experts agree that breastfeeding is the healthiest option for both mother and baby because of the difference in weight gain, breast-fed infants are generally thinner and slim than bottle fed infants. Bottle milk has limited nutrients as compared to mother's milk which make significant increase in health of the child. Breast-fed infants appear to self-regulate their energy intake at a lower level as compared to bottle-fed infants that have a lower metabolic rate.

So we can conclude that researchers have found differences between breast-fed infants and bottle-fed infants because one natural and the other is artificial.

Learn more about infants here: https://brainly.com/question/24726649

#SPJ1

What do early-onset alzheimer disease and huntington disease have in common?

Answers

Answer:

Alzheimer and Huntington disease both share a abnormal protein that attacks brain cells causing memory loss and other

Explanation:

The majority of studies conducted in athletes suggest that vitamin b12 injections boost red blood cell production.

a. true
b. false

Answers

The majority of research done on athletes indicate that vitamin B₁₂ injections increase the synthesis of red blood cells. Those claims are true.

Role of vitamin B₁₂:

Red blood cells, neurons, and DNA all require vitamin B12 for their creation and maintenance. Anemia, or a lack of red plasma cells, can result from inadequate vitamin B₁₂ intake and make you feel weak and exhausted. Your body's ability to hold onto oxygen and maintain endurance declines when you don't consume enough vitamin B₁₂ to produce red blood cells.Additionally, a vitamin B₁₂ deficiency might raise your risk of experiencing tingling and numbness of the skin, poor mental health, impaired cognitive function, and uncoordinated movements.According to some studies, athletes who do not get enough vitamin B₁₂in their diets may find it more difficult to engage in high-intensity activity. Higher vitamin B₁₂ levels are especially correlated with improved athletic performance in females. This is probably because vitamin B₁₂ helps the body regenerate tissues by repairing damaged cells and synthesizing new cells like red blood cells.

Therefore it is concluded that the questioned statement is true.

Learn more about vitamin B₁₂ here:

https://brainly.com/question/8965798

#SPJ4

The marshmallow task is a classic research experiment that demonstrates the importance of which concept?

Answers

Marshmallow task demonstrates the concept of delayed gratification.

What is the marshmallow test?

The marshmallow test is a research method that gauges a child's capacity for delaying gratification. The youngster has the choice of waiting a little time to acquire their preferred treat or, if they choose not to wait, getting a less-desired treat. A child's capacity to postpone gratification is measured in the minutes or seconds they wait.

The original marshmallow experiment demonstrated that the experimental conditions, such as the actual presence or lack of anticipated sweets, had a major impact on preschoolers' delay durations.

One of the most well-known studies in social science is the marshmallow test: Give a youngster a marshmallow, tell her she can have another one if she can wait 15 minutes after finishing the first, and then leave the room. It is said that a person's ability to maintain their composure long enough to double their reward is a sign of future success at work and in school. Many people view passing the test as an indication of future success.

I understand the question you are looking for is this:

The marshmallow task is a classic research experiment that demonstrates the importance of which concept?

a). Achievement expectations

b). Delayed gratification

c). Sustained attention

d). Goal setting

Learn more about marshmallow task here:

https://brainly.com/question/6336969

#SPJ4

The ovaries produce egg cells (cells that can be fertilized to start a pregnancy). Ovaries
also release hormones called estrogen and progesterone. Therefore, the ovaries belong
to which TWO systems? (check 2 boxes)
Integumentary
Endocrine
Urinary
Reproductive
Nervous

Answers

Answer:

reproductive and endocrine

Explanation:

endocrine because secrete hormones or other products directly into the blood.

reproductive because it produces egg cells for fertilization

D-snp plans are for only medicare beneficiaries that need help with medicare premiums true or false?.

Answers

D-snp plans are only for Medicare beneficiaries who need help with Medicare premiums. it is true.

What is D-snp plans?

Dual Eligible Special Needs Plans (D-SNPs) enroll individuals who are entitled to Medicare (Title XVIII) and health care from a state plan under Medicaid (Title XIX). States cover some Medicare costs, depending on the state and the individual's eligibility.

What is Medicare?

Medicare is the health insurance system managed by the government of the United States of America and intended for people aged 65 and over or who meet certain income criteria. The first law that put Medicare into practice was passed in 1965 as an addition to social security legislation.

With this information, we can conclude that Dual Eligible Special Needs Plans (D-SNPs) enroll individuals who are entitled to Medicare

Learn more about Medicare in brainly.com/question/14011571

#SPJ1

What purpose does a community health center serve in preventative and primary care?

Answers

Community health centres are outpatient clinics that provide primary care to a specific population, such as clients with young children or clients with diabetes.

Community health centres are designed to improve access to primary care services regardless of whether patients have insurance, speak languages other than English or Hindi, or live in remote areas.

These centres often target groups facing health disparities and limited care resources, including patients living in poverty, rural residents, veterans, and the homeless. Clinics typically use a sliding scale for fees and provide care even when patients cannot pay.

Typical services include:

Preventive and primary care services. (including medical and dental check-ups and condition management)Disease prevention. (vaccinations, anti-smoking programs, and obesity screenings)Patient education. (nutritional counselling, injury prevention, and disease information)Mental health services. (screenings and counselling)Substance abuse treatment.

By providing comprehensive preventive care and helping patients monitor chronic conditions, community health centres serve to lower medical costs by reducing expensive emergency department visits and hospital stays. Many of these centres operate as patient-centred medical homes (PCMHs).

Most community health centres receive federal grant funding under the Health Centre Program, which aims to improve health care for vulnerable populations. Many community health centres also receive funding and operational support from state agencies and non-profit charitable organizations.

To learn more about community health centres : https://brainly.com/question/10620528

#SPJ4

Which finding is a sign of circulatory compromise caused by a significant burn injury?

Answers

Ileus is a sign of circulatory compromise caused by a significant burn injury. the correct answer is option(b).

An injury to the skin or other organic tissue known as a burn is one that is primarily brought on by heat, radiation, radioactivity, electricity, friction, or contact with chemicals. 

Thermal (heat) burns happen when one or more of the following causes the skin's or other tissues' cells to die: (scalds)

Various burns include:

Mild first-degree burns (like most sunburns). Although the epidermis, the top layer of skin, often becomes red and uncomfortable, it rarely blisters.Skin's upper and lower layers (dermis) are affected by second-degree burns.The epidermis, dermis, and fat of the skin are all affected by third-degree burns.

as paralytic ileus, a condition brought on by a decline in intestinal motility and integrity. During the first two days of hypovolemic shock, this happens. The first symptom of burns with a TBSA of more than 25% is gastroparesis, which can progress to clinical ileus in more severe cases.

Which finding is a sign of circulatory compromise caused by a significant burn injury?

A. Urine output of 1 mL/kg/hour

B. Ileus

C. Facial blisters

D. Cherry-red skin

To know more about burn injury refer to:  https://brainly.com/question/14145208

#SPJ4

An increase in which factor causes urinary frequency in the first trimester of pregnancy?

Answers

An increase in which factor causes urinary frequency in the first trimester of pregnancy?

The bladder experiences increased pressure from the uterus.

What is urinary frequency?

In a 24-hour period, 6 to 7 urinations per day are considered normal for most people. If a person uses the restroom between 4 and 10 times a day and is healthy and content with this frequency, this is also considered to be normal.

Normal urine frequency is also influenced by the quantity and type of fluids you consume each day. Because of the way some medications function, such as "Diuretics," your blood pressure may rise if you take medication for high blood pressure, for instance. Your age and level of health and activity can also play a role; for example, children may urinate more frequently than adults do on average.

To learn more about urinary frequency from the given link:

https://brainly.com/question/13031653

#SPJ4

What is the systematic application of information and computer science and technology to public health practice, research, and learning? (co4)

Answers

The systematic application of information and computer science and technology to public health practise, research, and learning is referred to as public health informatics.

What is the importance of computer in public health practices ?

Computers have completely changed how medications are provided and what kind of medical care is necessary is now determined.

Doctors and nurses may thoroughly analyse a patient's whole medical history when they have access to correct patient records, which enables them to diagnose, treat, and deliver drugs in a timely manner.It identifies concerns with community health by keeping track of people's health status.Educates, informs, and empowers the community about health-related concerns.Creates plans and policies to promote community and individual health improvement initiatives.

Learn more about Public health practices here:

https://brainly.com/question/25647604

#SPJ4

After a recent fall by a resident, the nursing assistant is currently completing an incident (occurrence) report. The primary purpose of completing an incident (occurrence) report is it?

Answers

The primary purpose of completing an incident (occurrence) report is to make improvements in future safety.

What is incident (occurrence) report?

An incident (occurrence) report is a type of report usually written by health professional that provides a factual description of an adverse event.

There are different types of incidence (occurrence) report which include the following:

Near Miss Reports.

Injury and Lost Time Incident Report.

Exposure Incident Report, and

Sentinel Event Report.

The type of incidence report that should be written by the nurse is an Injury and Lost Time Incident Report which can make improvements in future safety of the resident.

Learn more about injury here:

https://brainly.com/question/19573072

#SPJ1

Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Answers

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

The methods for collecting, compiling, and presenting health information is called?

Answers

Answer:

health communications

Explanation:

methods for collecting, compiling, and presenting health information

-how we perceive info, combine info, and use info to make decisions

- health comm. is about info, from its collection to its use

Do you think your life could be improved by changing when or how long you sleep each day? in what ways? what negative effects do you think such changes might have on you?

Answers

Yes, definitely life can be improved by changing when and how much you sleep each day.

How much sleep is required for the proper functioning of the body?

Sleep is a state of rest that is given to the body which has been continuously working for the entire day.

As per the doctors, 6-8 hours of sleep is important for the normal physiology of the body. It is important to sleep in the dark because darkness induces the production of the chemical melatonin in the body which is responsible for sleep. So, first, it is important to sleep in dark. The next important thing is that there is a circadian rhythm of the body or it can be called a biological clock, if that clock is synchronized with the natural clock then the body’s physiology works very well. So, it is very important to sleep early which is between 10-11 pm, and wake up early which is between 4-5 am.

The above steps can be taken to improve the duration and timings of your sleep.

They don’t have any negative effects on the body, yes in the beginning your body will resist such changes but once you get habitual to it, you will feel the difference in the body’s physiology.

To know more about sleep visit here:

https://brainly.com/question/2064457

#SPJ4

At what height does a fall become severe enough for an adult to necessitate trauma services based solely on the mechanism of injury?

Answers

Answer:

height  20 ft.

Which individual is at an increased risk of dying in a famine, losing life to a wasting disease, and experiencing a poor outcome from surgery due to inadequate nutrient stores?

Answers

a person who is underweight is at an increased risk of dying in a famine, losing life to a wasting disease, and experiencing a poor outcome from surgery due to inadequate nutrient stores

A person is deemed to be underweight if their body weight is too low for them to be healthy. Animals are subject to the same principles. Underweight. The white area on the chart represents the body mass index (BMI) underweight range.

Using our BMI healthy weight calculator, which displays your body mass index, you can determine if you are underweight (BMI). Your weight can be too low if your BMI is less than 18.5. Inform your doctor or the practice nurse if you or someone you know is underweight.

To learn more about underweight please visit-
https://brainly.com/question/13106275
#SPJ4

In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except ________.

Answers

production of energy

In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except production of energy.

What is meant by balanced diet?A balanced diet is one that includes a variety of foods in the right amounts and ratios so that the body receives the proper amount of calories, proteins, minerals, vitamins, and other nutrients. A small portion of the diet is also set aside for extra nutrients to help the body maintain its lean state during the brief period of time when it is required to be lean.What are the essential seven ingredients for a healthy diet?It should be simpler to enjoy food and maintain good health if you have an understanding of the balance in your diet. Seven components are necessary for a balanced diet: water, carbohydrates, protein, fat, and fiberWhy is a balanced diet so crucial?You are shielded from a variety of degenerative noncommunicable diseases, including cancer, diabetes, and heart disease. A balanced diet that limits salt, sugar, saturated fats, and trans fats from industrial production is crucial for good health.

To learn more about diet visit:

https://brainly.com/question/24351545

#SPJ4

A Possible prevention of osteoporosis is

increasing vitamin D levels within the body.

increasing calcium and magnesium within the body.

taking anti-inflammatory drugs to reduce swelling.

correcting poor posture habits.

Answers

Answer:

Diet, vitamin D and weight-bearing exercise can help to prevent osteoporosis. If you have osteoporosis, medical treatment can prevent further bone loss and reduce your risk of bone fractures.

Explanation:

Correct Answer:

increasing calcium and magnesium

Explanation:

yes.

Which antidepressant class is most closely linked with anticholinergic side effects?

Answers

Tricyclic antidepressant (TCAs) class is most closely linked with anticholinergic side effects.

Amitriptyline, amoxapine, clomipramine and protriptyline are Tricyclic antidepressants (TCAs) that are used to treat chronic pain. Amitriptyline and nortriptyline among these medications provide the most reassuring safety information during pregnancy and breastfeeding.

In vitro and in vivo, TCAs are powerful inhibitors of norepinephrine and/or serotonin reuptake. In addition, several TCAs are known to block sodium, calcium, alpha-1 adrenoceptors, histamine (H1) receptors, and muscarinic cholinergic receptors. Thought to be responsible for their unfavourable anticholinergic, antihistaminergic, and cardiotoxic side effects rather than their antidepressant effects, these neurotransmitter receptor actions.

Learn more about TCAs here;

https://brainly.com/question/9919675

#SPJ4

Which is not a developmental task of adolescence? select one:
a. starting a vocation or career
b. becoming emotionally independent
c. developing personal values
d. learning to control behavior

Answers

Answer:

b is the correct answer

Explanation:

if u need more info on how to back it up let me know ill be glad to

Equipment food-contact surfaces used with potentially harzardous food must be cleaned throughout the day at least every __________ hours.

Answers

Equipment food-contact surfaces used with potentially hazardous food must be cleaned throughout the day at least every 4 hours.

Equipment and utensils used for any potentially hazardous foods must have their food surfaces cleaned at least every four hours. Additionally, it must be cleaned when while working with ready-to-eat foods instead than raw food preparation or when switching to a different kind of raw animal food at work from the previous one. When using potentially dangerous items, such as uncooked animal products with raw fruits and vegetables equipment and utensils must be cleaned.

If the potentially dangerous food is kept at a specified temperature and stored, ( that are less than 40 °F or higher than 135 °F) equipment and utensils with food contact surfaces must be cleaned less frequently than every four hours, but at least once every day or when utensils are empty.

To learn more about food-contact surfaces, hazardous food and utensils here,

https://brainly.com/question/28000353

#SPJ4

When a preschool-age child is developing a gender schema, she or he is __________.

Answers

When a preschool-age child is developing a gender schema, she or he is Using one's own cognitive skills to create "rules" about what is appropriate and inappropriate for males and females.

The psychologist Sandra Bem developed the gender schema hypothesis in 1981, which claimed that children pick up on male and female roles from the culture in which they are raised. The hypothesis contends that from the earliest stages of social development, kids modify their conduct to conform to the gender standards of their culture.

The cognitive revolution and Bem's aim to address what she saw as flaws in the psychoanalytic and social learning theories of the day both had an impact on her theory.

To learn more about gender schema click here

brainly.com/question/7277651

#SPJ4

Applies to during the concrete operational stage, children learn that many transformations by which changes can be undone.

Answers

At this stage of development, children are still highly literal and concrete in their thinking, but they become much better at applying logic. Kids get better at considering how other people might see a situation as they progress through the stages, and the egocentrism of the earlier stage starts to fade.

What is concrete operational stage in child development ?

Between the ages of 7 and 11 or 12, when a child is in the third stage, or the concrete operational stage, they start to think logically and start classifying objects based on their similarities and differences. The toddler also starts to understand the notions of time and number during this time.

According to Piaget, logical operations like conservation, reversibility, or classification, which enable logical reasoning, characterise thinking at this stage.

Learn more about concrete operational stage here:

https://brainly.com/question/14655682

#SPJ4

Which eye disorder can result from either an injury or infection and is treated with antibiotic eye drops and drops that temporarily paralyze the ciliary muscles to help control pain?

Answers

According to the research, the correct option is conjunctivitis, it is an eye disorder can result from either an injury or infection and is treated with antibiotic eye drops.

What is conjunctivitis?

It is a frequent pathology that inflames the conjunctiva and is sometimes accompanied by significant edema of the eyelid, the infection being of viral or bacterial origin or can result from either an injury.

Generally, if it is of bacterial origin with purulent discharge, the doctor prescribes antibiotics, which are usually topical drops or ointment to help control pain.

Therefore, we can conclude that according to the research, the correct option is conjunctivitis, it is an eye disorder can result from either an injury or infection and is treated with antibiotic eye drops.

Learn more about conjunctivitis here: https://brainly.com/question/14938345

#SPJ1

The hpv vaccine is nearly 100ffective in preventing ___ strains of hpv that cause warts and cervical cancer

Answers

The HPV vaccine is nearly 100% effective in preventing type 16 and type 18 strains of HPV that cause warts and cervical cancer.

The HPV vaccine Gardasil 9 protects against infection from nine HPV types: the two low-risk HPV types that cause most genital warts, plus the seven high-risk HPV types that cause most HPV-related cancers.

Human Papilloma Virus or HPV-related cancers often take years to develop after getting an HPV infection.

HPV infects the squamous cells that line the inner surfaces of these organs. For this reason, most HPV-related cancers are a type of cancer called squamous cell carcinoma.

To learn more about HPV vaccine ,here

https://brainly.com/question/6985320

#SPJ4

A person who exhibits sudden paralysis while remaining conscious may be suffering from?

Answers

A person who exhibits sudden paralysis while remaining conscious may be suffering from an episode of cataplexy.

Cataplexy:

While a person is awake, cataplexy is an abrupt loss of muscle tone that causes weakness and a lack of voluntary muscle control. Strong, sudden emotions like laughter, anxiety, rage, tension, or excitement are frequently what set it off.

The reduction of muscular tone experienced during cataplexy is comparable to the natural paralysis of muscle activity experienced during REM sleep. At most a few minutes long, episodes end very immediately on their own. The episodes are frightening, but as long as the person finds a secure location to collapse, they are not harmful. While cataplexy happens once a person is completely awake, sleep paralysis occurs at the borders of sleep.

Learn more about paralysis here:

https://brainly.com/question/7249786

#SPJ4

Other Questions
Question 5 & 6 plissssssss Explain this statement: governments should use fiscal policies to keep the economy moving, even if a little hobbled. In a majority of the state conventions to ratify the constitution (8 of 13), it was claimed that ______ would have the power to nullify actions that violated the constitution. Each person who applies for an assembly job at Robert's Electronics is given a mechanical aptitude test. One part of the test involves assembling a plug-in unit based on numbered instructions. A sample of the length of time it took 42 persons to assemble the unit was organized into the following frequency distribution. Length of Time (in minutes) Number 1 up to 4 4 4 up to 7 8 7 up to 10 14 10 up to 13 9 13 up to 16 5 16 up to 19 2 What is the mean (in minutes) one endpoint of a line segment is (1,2) and the midpoint of the midpoint of the segment is (-1,4) what is the other end point ? Please give me a correct answer and the step by step explanation. Landfills are advantageous for wastedisposal for many reasons. Which of thefollowing is an advantage of landfills?A. They have cheaper disposal fees.B. They are very expensive.C. They are high maintenance.D. They produce little to no smell. 30 POINTS FOR THIS QUESTION How many connections are needed to connect 6 devices in a mesh topology assuming only a single connection between any two devices? The cost of operating an electrical appliance is based upon itsAage.Bease of use.Cwattage and time used.D original purchase price. The first attempt of the basic design of a new toy is shown.6 in16 in10 in8 in24 inWhat is the surface area of the new toy to the nearest square inch? What are your greatest strengths? What type of test benefits individuals who are unable to undergo routine exercise stress testing because of extreme deconditioning, orthopedic disabilities, or other health problems Generally the number of immigrants that come to the united states rises and falls with the united states?. 450n 360n 710n 1400n 230n a block is placed in oscillation on a frictionless horizontal surface attached to a spring that is also attached to a wall. If, when stretched away from equilibrium by 15cm and released, it oscillates with a period of 0. 25s, and if the mass of the block is 15kg, what force was required to stretch the spring by the initial 15cm?. What is the solution to the compound inequality in interval notation?4(x+1)>4 or 2x410(, 3] or (2, )(3, 2](, 2) or [3, )(, 3] or (2, ) list determinants of foreign policies and explain how they affects behavior of states? The popular belief in democracy works to the advantage of the? Describe and explain, how and why, the Great Durban Metro (eThekwini) failed to adequately manage storm and runoff water. Focus specifically on the April 2022 floods and its aftermath. A variable that takes on the values of 0 or 1 and is used to incorporate the effect of categorical variables in a regression model is called?