A health psychologist would be most likely to conduct research assessing the relationship between:________.

Answers

Answer 1

A health psychologist would be most likely to conduct research assessing the relationship between unprotected s--ex and sexually transmitted diseases.

Who is a health psychologist?

Psychology is a branch of science that is concerned with the study of human behavior and the mental processes. We know that psychology adopts the scientific method in its approach hence the study has been classified as a science and not as an art.

Now, health psychologist is mostly preoccupied with the nature of the relationship between human beings and illnesses especially as regards the way in which individuals are able to effectively manage various diseases conditions from which they suffer.

Thus, a health psychologist would be most likely to conduct research assessing the relationship between unprotected s--ex and sexually transmitted diseases.

Learn more about psychology:https://brainly.com/question/10980588

#SPJ1


Related Questions

The sensory component of pain is to _____ as the emotional component of pain is to _____

Answers

The sensory component of pain is to throbbing as the emotional component of pain is too annoying.

In general, pain has 2 components

1) Sensory

2) Emotional

The sensory component of pain is to throbbing as the emotional component of pain is too annoying.

Pain is a modality of protection, whereas the majority of sensory and somatosensory modalities are primarily informational.

Because pain is both a discriminative sensation and a graded emotional experience connected to existing or potential tissue damage, it varies from the classical senses (hearing, smell, taste, touch, and vision).

A sub modality of somatic sense is pain. A wide variety of unpleasant sensory and mental sensations connected to existing or potential tissue injury are referred to as "pain."

Learn more about pain here https://brainly.com/question/15073046

#SPJ4

As your skeletal muscles contract during physical activity, more blood is returned to the heart. which variable would be affected and what would be the outcome of this action?

Answers

A greater cardiac output would arise from an increase in preload.

What is cardiac output?Cardiac output, which is calculated as the sum of stroke volume and heart rate and expressed in liters per minute. The most typical definition of HR is how many times it beats in a minute. SV is the amount of blood expelled during each heartbeat or ventricular contraction.Cardiac output, which is determined by the heart's pace, contractility, preload, and afterload, is the volume of blood it can pump in a minute.When evaluating cardiac output values, it's crucial to comprehend how each of these four components applies and how it relates to everyday life.When a person is at rest, a healthy heart with a normal cardiac output pumps 5 to 6 litres of blood every minute.The volume of blood that the heart circulates across the body in a minute. The stroke volume refers to the volume of blood that the left ventricle of the heart pumps during a single contraction. The cardiac output is determined by the heart rate and stroke volume.

Learn more about cardiac output here:

https://brainly.com/question/1050328

#SPJ4

What is the emerging disease with signs and symptoms of vomiting, diarrhea, fever, pain, and headache, and internal and external bleeding?

Answers

Ebola virus disease  is the emerging disease with signs and symptoms of vomiting, diarrhea, fever, pain, and headache, and internal and external bleeding

The Ebola virus sickness is a serious and frequently fatal illness brought on by Ebola viruses. Up to 90% of cases during EVD outbreaks end in death. Hemorrhagic fever is a disorder that can be caused by other viruses as well, but Ebola viruses produce one of the most deadly versions.

The more severe forms of hemorrhagic fever can also result in blood vessel destruction and significant external bleeding in addition to the other symptoms of the condition, which include include fever, headache, muscle pain, weakness, vomiting, and diarrhoea (hemorrhage). The mortality rate for EVD can range from 25% to 90%.

Although novel therapies and vaccines are being investigated, there are currently no approved medications or vaccines to treat EVD.

Learn more about ebola virus here;

https://brainly.com/question/836713

#SPJ4

After a recent fall by a resident, the nursing assistant is currently completing an incident (occurrence) report. The primary purpose of completing an incident (occurrence) report is it?

Answers

The primary purpose of completing an incident (occurrence) report is to make improvements in future safety.

What is incident (occurrence) report?

An incident (occurrence) report is a type of report usually written by health professional that provides a factual description of an adverse event.

There are different types of incidence (occurrence) report which include the following:

Near Miss Reports.

Injury and Lost Time Incident Report.

Exposure Incident Report, and

Sentinel Event Report.

The type of incidence report that should be written by the nurse is an Injury and Lost Time Incident Report which can make improvements in future safety of the resident.

Learn more about injury here:

https://brainly.com/question/19573072

#SPJ1

Which is not a developmental task of adolescence? select one:
a. starting a vocation or career
b. becoming emotionally independent
c. developing personal values
d. learning to control behavior

Answers

Answer:

b is the correct answer

Explanation:

if u need more info on how to back it up let me know ill be glad to

Do you think your life could be improved by changing when or how long you sleep each day? in what ways? what negative effects do you think such changes might have on you?

Answers

Yes, definitely life can be improved by changing when and how much you sleep each day.

How much sleep is required for the proper functioning of the body?

Sleep is a state of rest that is given to the body which has been continuously working for the entire day.

As per the doctors, 6-8 hours of sleep is important for the normal physiology of the body. It is important to sleep in the dark because darkness induces the production of the chemical melatonin in the body which is responsible for sleep. So, first, it is important to sleep in dark. The next important thing is that there is a circadian rhythm of the body or it can be called a biological clock, if that clock is synchronized with the natural clock then the body’s physiology works very well. So, it is very important to sleep early which is between 10-11 pm, and wake up early which is between 4-5 am.

The above steps can be taken to improve the duration and timings of your sleep.

They don’t have any negative effects on the body, yes in the beginning your body will resist such changes but once you get habitual to it, you will feel the difference in the body’s physiology.

To know more about sleep visit here:

https://brainly.com/question/2064457

#SPJ4

In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except ________.

Answers

production of energy

In the case of a person who consumes a normal, balanced diet, proteins are essential to the body for all of the following except production of energy.

What is meant by balanced diet?A balanced diet is one that includes a variety of foods in the right amounts and ratios so that the body receives the proper amount of calories, proteins, minerals, vitamins, and other nutrients. A small portion of the diet is also set aside for extra nutrients to help the body maintain its lean state during the brief period of time when it is required to be lean.What are the essential seven ingredients for a healthy diet?It should be simpler to enjoy food and maintain good health if you have an understanding of the balance in your diet. Seven components are necessary for a balanced diet: water, carbohydrates, protein, fat, and fiberWhy is a balanced diet so crucial?You are shielded from a variety of degenerative noncommunicable diseases, including cancer, diabetes, and heart disease. A balanced diet that limits salt, sugar, saturated fats, and trans fats from industrial production is crucial for good health.

To learn more about diet visit:

https://brainly.com/question/24351545

#SPJ4

An increase in which factor causes urinary frequency in the first trimester of pregnancy?

Answers

An increase in which factor causes urinary frequency in the first trimester of pregnancy?

The bladder experiences increased pressure from the uterus.

What is urinary frequency?

In a 24-hour period, 6 to 7 urinations per day are considered normal for most people. If a person uses the restroom between 4 and 10 times a day and is healthy and content with this frequency, this is also considered to be normal.

Normal urine frequency is also influenced by the quantity and type of fluids you consume each day. Because of the way some medications function, such as "Diuretics," your blood pressure may rise if you take medication for high blood pressure, for instance. Your age and level of health and activity can also play a role; for example, children may urinate more frequently than adults do on average.

To learn more about urinary frequency from the given link:

https://brainly.com/question/13031653

#SPJ4

In a disease, a(n) ______ mutation causes the dna sequence aga which encodes the mrna codon ucu and specifies arginine to change to agc that encodes ucg in the mrna and specifies serine.

Answers

Answer:missense mutation

Explanation:

When a preschool-age child is developing a gender schema, she or he is __________.

Answers

When a preschool-age child is developing a gender schema, she or he is Using one's own cognitive skills to create "rules" about what is appropriate and inappropriate for males and females.

The psychologist Sandra Bem developed the gender schema hypothesis in 1981, which claimed that children pick up on male and female roles from the culture in which they are raised. The hypothesis contends that from the earliest stages of social development, kids modify their conduct to conform to the gender standards of their culture.

The cognitive revolution and Bem's aim to address what she saw as flaws in the psychoanalytic and social learning theories of the day both had an impact on her theory.

To learn more about gender schema click here

brainly.com/question/7277651

#SPJ4

Why is it important to dress in layers during the winter?

Layers of clothing keep you dry.
Layers of clothing trap your body's heat.
Layers of clothing help prevent frostbite and hypothermia.
all of the above

Answers

The answer to this question is all of the above. Why? Well, see below for an explanation!

It is important to dress in layers during the winter because first off, snow is liquid but is maintained in a solid and fluffy state due to low temperatures. That being said, the snow can melt in your hands or anywhere on your body if you do not wear the appropriate clothing. Layering down in clothing while it is wintertime can prevent snow from getting your body wet. It is also important to dress down in layers during wintertime because layers of clothing trap your body’s heat. All humans’ bodies give off internal heat and when you dress in layers, that heat is sustained within your clothing so you stay warm. Lastly, layering your clothing during wintertime can help prevent frostbite and hypothermia. Frostbite is a condition that is most common during the winter where your skin and its tissue freeze. If any of your body parts are exposed, it is likely that you could get frostbite. Hypothermia is a dangerous condition in which your body temperature significantly drops. If this continually happens without any treatment or address of the situation, you could potentially freeze to death.

Your final answer: Because all of these answers have correct explanations for why it is important to dress in layers during wintertime, your answer is “all of the above.” If you need help, let me know and I will gladly assist you.

Which goal of cancer treatment plan focuses on cancers that cannot be eradicated but are responsive for?

Answers

Palliation control is the goal of cancer treatment plan which focuses on cancers that cannot be eradicated but are responsive to anticancer therapies.

The treatment used to reduce symptoms or give relief is known as palliative care. For example, anti-nausea treatments or pain medicines are palliative and hence can be used at all stages of treatment.

It cannot be exactly told when chemotherapy is used as a palliative treatment since most often it is associated with curing or controlling the cancer. However, chemotherapy becomes part of a palliative care plan when it is deployed in order to provide comfort to the patient.

Chemotherapy can be used to reduce the size of a tumor which is generating pain to make the patient feel better and experience less pain.

To learn more about palliative care here

https://brainly.com/question/19580009

#SPJ4

What purpose does a community health center serve in preventative and primary care?

Answers

Community health centres are outpatient clinics that provide primary care to a specific population, such as clients with young children or clients with diabetes.

Community health centres are designed to improve access to primary care services regardless of whether patients have insurance, speak languages other than English or Hindi, or live in remote areas.

These centres often target groups facing health disparities and limited care resources, including patients living in poverty, rural residents, veterans, and the homeless. Clinics typically use a sliding scale for fees and provide care even when patients cannot pay.

Typical services include:

Preventive and primary care services. (including medical and dental check-ups and condition management)Disease prevention. (vaccinations, anti-smoking programs, and obesity screenings)Patient education. (nutritional counselling, injury prevention, and disease information)Mental health services. (screenings and counselling)Substance abuse treatment.

By providing comprehensive preventive care and helping patients monitor chronic conditions, community health centres serve to lower medical costs by reducing expensive emergency department visits and hospital stays. Many of these centres operate as patient-centred medical homes (PCMHs).

Most community health centres receive federal grant funding under the Health Centre Program, which aims to improve health care for vulnerable populations. Many community health centres also receive funding and operational support from state agencies and non-profit charitable organizations.

To learn more about community health centres : https://brainly.com/question/10620528

#SPJ4

The marshmallow task is a classic research experiment that demonstrates the importance of which concept?

Answers

Marshmallow task demonstrates the concept of delayed gratification.

What is the marshmallow test?

The marshmallow test is a research method that gauges a child's capacity for delaying gratification. The youngster has the choice of waiting a little time to acquire their preferred treat or, if they choose not to wait, getting a less-desired treat. A child's capacity to postpone gratification is measured in the minutes or seconds they wait.

The original marshmallow experiment demonstrated that the experimental conditions, such as the actual presence or lack of anticipated sweets, had a major impact on preschoolers' delay durations.

One of the most well-known studies in social science is the marshmallow test: Give a youngster a marshmallow, tell her she can have another one if she can wait 15 minutes after finishing the first, and then leave the room. It is said that a person's ability to maintain their composure long enough to double their reward is a sign of future success at work and in school. Many people view passing the test as an indication of future success.

I understand the question you are looking for is this:

The marshmallow task is a classic research experiment that demonstrates the importance of which concept?

a). Achievement expectations

b). Delayed gratification

c). Sustained attention

d). Goal setting

Learn more about marshmallow task here:

https://brainly.com/question/6336969

#SPJ4

Which eye disorder can result from either an injury or infection and is treated with antibiotic eye drops and drops that temporarily paralyze the ciliary muscles to help control pain?

Answers

According to the research, the correct option is conjunctivitis, it is an eye disorder can result from either an injury or infection and is treated with antibiotic eye drops.

What is conjunctivitis?

It is a frequent pathology that inflames the conjunctiva and is sometimes accompanied by significant edema of the eyelid, the infection being of viral or bacterial origin or can result from either an injury.

Generally, if it is of bacterial origin with purulent discharge, the doctor prescribes antibiotics, which are usually topical drops or ointment to help control pain.

Therefore, we can conclude that according to the research, the correct option is conjunctivitis, it is an eye disorder can result from either an injury or infection and is treated with antibiotic eye drops.

Learn more about conjunctivitis here: https://brainly.com/question/14938345

#SPJ1

What would be the best advice to give someone who wants to retain good cognitive functioning?

Answers

Answer: Exercise your body and your mind, use it or lose it.

How does hunger and appetite differ in the way they influence our desire to eat?

Answers

Hunger is controlled by internal body mechanisms regulated by internal cues whereas appetite is controlled by external food choice mechanisms such as environmental.

Hunger is physiological. It occurs because of biological changes throughout the body, which signal that you need to eat to maintain energy levels.

Appetite is simply the desire to eat. It can be a result of hunger, but often has other causes, such as emotional or environmental conditions. It can also be a learned behavior.

For example, feeling very stressed, upset, or bored can increase appetite even when you aren’t really hungry.

To learn more about Hunger and Appetite, here

brainly.com/question/2929541

#SPJ4

List five ways to incorporate safety while being active and tell why each is important.

Answers

Why is it important to have safety while doing physical activity?

Overview. Practicing exercise safety helps optimize the health benefits of a fitness routine. When planning an exercise program, it's important to consider factors such as age and health history as well as personal strength and stamina.

Five ways to incorporate safety while being active -Use safety equipment.Warm up to your workout. Drink plenty of fluids when you are physically active, even if you are not thirsty.Always bend forward from the hips, not the waist. Stop being active if you feel very out of breath, dizzy, or nauseated or have pain.

Learn more about being active

brainly.com/question/8475261

#SPJ4

The correct spelling of the medical term that indicates forward movement in the gastrointestinal tract is ______________.

Answers

I believe it is Peristalsis :)

what is the function of vaccination

Answers

Answer:

To understand how vaccines work, it helps to first look at how the body fights illness. When germs, such as bacteria or viruses, invade the body, they attack and multiply. This invasion, called an infection, is what causes disease. The immune system uses your white blood cells to fight infection.

Explanation:

How Vaccines Work

Vaccines can help protect against certain diseases by imitating an infection. This type of imitation infection, helps teach the immune system how to fight off a future infection. Sometimes, after getting a vaccine, the imitation infection can cause minor symptoms, such as fever. Such minor symptoms are normal and should be expected as the body builds immunity.

Once the vaccinated body is left with a supply of T-lymphocytes and B-lymphocytes that will remember how to fight that disease. However, it typically takes a few weeks for the body to produce T-lymphocytes and B-lymphocytes after vaccination. Therefore, it is possible that a person infected with a disease just before or just after vaccination could develop symptoms and get that disease, because the vaccine has not had enough time to provide protection. While vaccines are the safest way to protect a person from a disease, no vaccine is perfect. It is possible to get a disease even when vaccinated, but the person is less likely to become seriously ill.

types of vaccine:

Live, attenuated vaccinesToxoid vaccines Non-live vaccines

Answer:

Vaccination helps the body's immune system to build a defense mechanism to guard against the diseases.

Hope its helpful :-)

What are the rules dealing with the deductibility of the cost of meals while away from home in order to receive medical treatment as an outpatient?

Answers

What are the rules dealing with the deductibility of the cost of meals while away from home in order to receive medical treatment as an outpatient?

Meals are typically not deductible for patients who are undergoing outpatient care while away from home.

What is outpatient?

A patient who doesn't stay the night but attends a hospital for a diagnostic or treatment. Occasionally known as a day patient.

The area of a hospital designated for the care of outpatients, or people with health issues who visit the facility for diagnosis or treatment but do not currently need a bed or to be admitted for overnight care, is known as an outpatient department or outpatient clinic. Modern outpatient clinics provide a variety of medical treatments, diagnostic testing, and non-invasive surgeries.

To learn more about outpatient from given link:

https://brainly.com/question/22599476

#SPJ4

The methods for collecting, compiling, and presenting health information is called?

Answers

Answer:

health communications

Explanation:

methods for collecting, compiling, and presenting health information

-how we perceive info, combine info, and use info to make decisions

- health comm. is about info, from its collection to its use

A Possible prevention of osteoporosis is

increasing vitamin D levels within the body.

increasing calcium and magnesium within the body.

taking anti-inflammatory drugs to reduce swelling.

correcting poor posture habits.

Answers

Answer:

Diet, vitamin D and weight-bearing exercise can help to prevent osteoporosis. If you have osteoporosis, medical treatment can prevent further bone loss and reduce your risk of bone fractures.

Explanation:

Correct Answer:

increasing calcium and magnesium

Explanation:

yes.

At what height does a fall become severe enough for an adult to necessitate trauma services based solely on the mechanism of injury?

Answers

Answer:

height  20 ft.

Equipment food-contact surfaces used with potentially harzardous food must be cleaned throughout the day at least every __________ hours.

Answers

Equipment food-contact surfaces used with potentially hazardous food must be cleaned throughout the day at least every 4 hours.

Equipment and utensils used for any potentially hazardous foods must have their food surfaces cleaned at least every four hours. Additionally, it must be cleaned when while working with ready-to-eat foods instead than raw food preparation or when switching to a different kind of raw animal food at work from the previous one. When using potentially dangerous items, such as uncooked animal products with raw fruits and vegetables equipment and utensils must be cleaned.

If the potentially dangerous food is kept at a specified temperature and stored, ( that are less than 40 °F or higher than 135 °F) equipment and utensils with food contact surfaces must be cleaned less frequently than every four hours, but at least once every day or when utensils are empty.

To learn more about food-contact surfaces, hazardous food and utensils here,

https://brainly.com/question/28000353

#SPJ4

What do early-onset alzheimer disease and huntington disease have in common?

Answers

Answer:

Alzheimer and Huntington disease both share a abnormal protein that attacks brain cells causing memory loss and other

Explanation:

Which food would be an inappropriate choice to feed a child with spastic quadriplegia?

Answers

Answer:

wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj

Explanation:

A client's most recent diagnostic imaging has revealed that lung cancer has metastasized to the bones and liver. what is the most likely mechanism by which the client's cancer cells spread?

Answers

Lymphatic circulation is the way by which the client's cancer cells spread to the bones and liver.

Small blood arteries can be used by cancer cells to enter the bloodstream. These cells are known as circulating tumor cells (or CTCs). to assist in cancer diagnosis and therapy vigilance. The cancer cells are carried by the moving blood until they become lodged.Once cancer cells have broken out from the initial tumor and are in the bloodstream, they circulate as single cells or cell clusters (sometimes referred to as CTCs) until they are stopped in the capillary beds that feed the following organ in the circulatory system and remove waste.The term "circulating tumor cells" (CTCs) refers to tumor cells that have exfoliated from the main tumor and extravasated into the bloodstream, where they circulate.

learn more about cancer here: https://brainly.com/question/11710623

#SPJ4

Applies to during the concrete operational stage, children learn that many transformations by which changes can be undone.

Answers

At this stage of development, children are still highly literal and concrete in their thinking, but they become much better at applying logic. Kids get better at considering how other people might see a situation as they progress through the stages, and the egocentrism of the earlier stage starts to fade.

What is concrete operational stage in child development ?

Between the ages of 7 and 11 or 12, when a child is in the third stage, or the concrete operational stage, they start to think logically and start classifying objects based on their similarities and differences. The toddler also starts to understand the notions of time and number during this time.

According to Piaget, logical operations like conservation, reversibility, or classification, which enable logical reasoning, characterise thinking at this stage.

Learn more about concrete operational stage here:

https://brainly.com/question/14655682

#SPJ4

Which finding is a sign of circulatory compromise caused by a significant burn injury?

Answers

Ileus is a sign of circulatory compromise caused by a significant burn injury. the correct answer is option(b).

An injury to the skin or other organic tissue known as a burn is one that is primarily brought on by heat, radiation, radioactivity, electricity, friction, or contact with chemicals. 

Thermal (heat) burns happen when one or more of the following causes the skin's or other tissues' cells to die: (scalds)

Various burns include:

Mild first-degree burns (like most sunburns). Although the epidermis, the top layer of skin, often becomes red and uncomfortable, it rarely blisters.Skin's upper and lower layers (dermis) are affected by second-degree burns.The epidermis, dermis, and fat of the skin are all affected by third-degree burns.

as paralytic ileus, a condition brought on by a decline in intestinal motility and integrity. During the first two days of hypovolemic shock, this happens. The first symptom of burns with a TBSA of more than 25% is gastroparesis, which can progress to clinical ileus in more severe cases.

Which finding is a sign of circulatory compromise caused by a significant burn injury?

A. Urine output of 1 mL/kg/hour

B. Ileus

C. Facial blisters

D. Cherry-red skin

To know more about burn injury refer to:  https://brainly.com/question/14145208

#SPJ4

Other Questions
A playa is a(n) __________. a. natural lake that is dry for long periods of time b. underground water reserve c. man-made freshwater reservoir d. navigable river waterway please select the best answer from the choices provided. a b c d Role of students in establishing social peace Do you think television plays a greater role in uniting us as a culture or in separating us as individuals? how and why? The ________ details how the business expects to go from the beginning cash balance to the desired ending cash balance. Blue cross established its first hospital insurance plan at __________ in 1929 by agreeing to provide 1,500 teachers with 21 days of hospital care per year at a price of $6 per person. Joyce paid $108.00 for an item at the store that was 40 percent off the original price. What was the original price? Where are the hormones oxytocin and antidiuretic hormone (adh) stored? Mr. Edwards, a marketing representative of the ACME Insurance Company, scheduled a marketing event and expects about 40 people to attend. He has hired a magician for $200 to entertain attendees. Can he do this in a way that complies with guidance from the Medicare agency? School systems have widely differing practices regarding the education of students with special gifts and talents because? The human eye has an osmotic pressure of 8. 00 atm at 37. 0 c. what concentration (in moles/l) of a saline (nacl) solution will provide an isotonic eyedrop solution? A painter needs to measure the height from the ground to the base of a 2nd story window. He props his ladder against the base of the window. He finds the height from one rung of the ladder to the point on the ground below it, and the distance from that point to the base of the ladder. This is shown in the figure.If XY = 8 inches, WY = 24 inches, and XZ = 48 inches, the height from the ground to the base of the window is inches. _____ occurs when making accommodations for individuals with disabilities imposes a significant difficulty or expense on an employer. ________ If an arc has measure 7/4 radians, what is its measure in degrees?________ What is 60 in radians? What are two examples of economic forces within a company's general environment? The information security function in a large organization is most effective when:_____ _________ can take many different forms ranging from human organs to computer software. Find mEHF. PLEASE HELP ASAP In operant conditioning, ________ is necessary to create the association between the stimulus and the repetition of a voluntary response. a long time delay the law of negative effect reinforcement According to ross thompson's perspective, children ______ than piaget envisioned. find the value of a x 7 when a=6